KEGG   Homo sapiens (human): 3593Help
Entry
3593              CDS       T01001                                 

Gene name
IL12B, CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2
Definition
interleukin 12B
Orthology
K05425  
interleukin 12B
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Jak-STAT signaling pathway
Type I diabetes mellitus
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Toxoplasmosis
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Proteoglycans in cancer
Inflammatory bowel disease (IBD)
Allograft rejection
Disease
H00089  
IFN-gamma/IL-12 axis
Drug target
Ustekinumab: 
Briakinumab: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3593 (IL12B)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3593 (IL12B)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3593 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    3593 (IL12B)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    3593 (IL12B)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    3593 (IL12B)
   05330 Allograft rejection
    3593 (IL12B)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3593 (IL12B)
  Infectious diseases
   05133 Pertussis
    3593 (IL12B)
   05134 Legionellosis
    3593 (IL12B)
   05152 Tuberculosis
    3593 (IL12B)
   05162 Measles
    3593 (IL12B)
   05164 Influenza A
    3593 (IL12B)
   05168 Herpes simplex infection
    3593 (IL12B)
   05146 Amoebiasis
    3593 (IL12B)
   05145 Toxoplasmosis
    3593 (IL12B)
   05140 Leishmaniasis
    3593 (IL12B)
   05142 Chagas disease (American trypanosomiasis)
    3593 (IL12B)
   05143 African trypanosomiasis
    3593 (IL12B)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  3593 (IL12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5q31.1-q33.1
AA seq 328 aa AA seqDB search
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV
RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
RKNASISVRAQDRYYSSSWSEWASVPCS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcaccagcagttggtcatctcttggttttccctggtttttctggcatctcccctc
gtggccatatgggaactgaagaaagatgtttatgtcgtagaattggattggtatccggat
gcccctggagaaatggtggtcctcacctgtgacacccctgaagaagatggtatcacctgg
accttggaccagagcagtgaggtcttaggctctggcaaaaccctgaccatccaagtcaaa
gagtttggagatgctggccagtacacctgtcacaaaggaggcgaggttctaagccattcg
ctcctgctgcttcacaaaaaggaagatggaatttggtccactgatattttaaaggaccag
aaagaacccaaaaataagacctttctaagatgcgaggccaagaattattctggacgtttc
acctgctggtggctgacgacaatcagtactgatttgacattcagtgtcaaaagcagcaga
ggctcttctgacccccaaggggtgacgtgcggagctgctacactctctgcagagagagtc
agaggggacaacaaggagtatgagtactcagtggagtgccaggaggacagtgcctgccca
gctgctgaggagagtctgcccattgaggtcatggtggatgccgttcacaagctcaagtat
gaaaactacaccagcagcttcttcatcagggacatcatcaaacctgacccacccaagaac
ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac
acctggagtactccacattcctacttctccctgacattctgcgttcaggtccagggcaag
agcaagagagaaaagaaagatagagtcttcacggacaagacctcagccacggtcatctgc
cgcaaaaatgccagcattagcgtgcgggcccaggaccgctactatagctcatcttggagc
gaatgggcatctgtgccctgcagttag

DBGET integrated database retrieval system