KEGG   Homo sapiens (human): 3596Help
Entry
3596              CDS       T01001                                 

Gene name
IL13, IL-13, P600
Definition
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04664  Fc epsilon RI signaling pathway
hsa05162  Measles
hsa05200  Pathways in cancer
hsa05310  Asthma
hsa05321  Inflammatory bowel disease (IBD)
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00079  Asthma
H00084  Graft-versus-host disease
H01358  Atopic dermatitis
H01360  Allergic rhinitis
Drug target
Anrukinzumab: D08857
Lebrikizumab: D09633
Tralokinumab: D09979
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3596 (IL13)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3596 (IL13)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    3596 (IL13)
   04657 IL-17 signaling pathway
    3596 (IL13)
   04664 Fc epsilon RI signaling pathway
    3596 (IL13)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3596 (IL13)
  Immune diseases
   05310 Asthma
    3596 (IL13)
   05321 Inflammatiory bowel disease (IBD)
    3596 (IL13)
  Infectious diseases
   05162 Measles
    3596 (IL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3596 (IL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL13
Motif
Other DBs
NCBI-GeneID: 3596
NCBI-ProteinID: NP_002179
OMIM: 147683
HGNC: 5973
Ensembl: ENSG00000169194
Vega: OTTHUMG00000059723
Pharos: P35225(Tbio)
UniProt: P35225
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 146 aa AA seqDB search
MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP
LCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD
TKIEVAQFVKDLLLHLKKLFREGQFN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgctcctcaatcctctcctgttggcactgggcctcatggcgcttttgttgacc
acggtcattgctctcacttgccttggcggctttgcctccccaggccctgtgcctccctct
acagccctcagggagctcattgaggagctggtcaacatcacccagaaccagaaggctccg
ctctgcaatggcagcatggtatggagcatcaacctgacagctggcatgtactgtgcagcc
ctggaatccctgatcaacgtgtcaggctgcagtgccatcgagaagacccagaggatgctg
agcggattctgcccgcacaaggtctcagctgggcagttttccagcttgcatgtccgagac
accaaaatcgaggtggcccagtttgtaaaggacctgctcttacatttaaagaaacttttt
cgcgagggacagttcaactga

DBGET integrated database retrieval system