KEGG   Homo sapiens (human): 3596Help
Entry
3596              CDS       T01001                                 

Gene name
IL13, IL-13, P600
Definition
interleukin 13
Orthology
K05435  
interleukin 13
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Fc epsilon RI signaling pathway
Measles
Asthma
Inflammatory bowel disease (IBD)
Disease
H00079  
Asthma
H00084  
Graft-versus-host disease
H01358  
Atopic dermatitis
H01360  
Allergic rhinitis
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3596 (IL13)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3596 (IL13)
 Organismal Systems
  Immune system
   04664 Fc epsilon RI signaling pathway
    3596 (IL13)
 Human Diseases
  Immune diseases
   05310 Asthma
    3596 (IL13)
   05321 Inflammatiory bowel disease (IBD)
    3596 (IL13)
  Infectious diseases
   05162 Measles
    3596 (IL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5q31
AA seq 146 aa AA seqDB search
MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP
LCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD
TKIEVAQFVKDLLLHLKKLFREGQFN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgctcctcaatcctctcctgttggcactgggcctcatggcgcttttgttgacc
acggtcattgctctcacttgccttggcggctttgcctccccaggccctgtgcctccctct
acagccctcagggagctcattgaggagctggtcaacatcacccagaaccagaaggctccg
ctctgcaatggcagcatggtatggagcatcaacctgacagctggcatgtactgtgcagcc
ctggaatccctgatcaacgtgtcaggctgcagtgccatcgagaagacccagaggatgctg
agcggattctgcccgcacaaggtctcagctgggcagttttccagcttgcatgtccgagac
accaaaatcgaggtggcccagtttgtaaaggacctgctcttacatttaaagaaacttttt
cgcgagggacagttcaactga

DBGET integrated database retrieval system