KEGG   Homo sapiens (human): 3596Help
Entry
3596              CDS       T01001                                 

Gene name
IL13, IL-13, P600
Definition
interleukin 13
Orthology
K05435  
interleukin 13
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Fc epsilon RI signaling pathway
Measles
Asthma
Inflammatory bowel disease (IBD)
Disease
H00079  
Asthma
H00084  
Graft-versus-host disease
H01358  
Atopic dermatitis
H01360  
Allergic rhinitis
Drug target
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Human Diseases; Immune diseases; Asthma [PATH:hsa05310]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5q31
AA seq 146 aa AA seqDB search
MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP
LCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD
TKIEVAQFVKDLLLHLKKLFREGQFN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgctcctcaatcctctcctgttggcactgggcctcatggcgcttttgttgacc
acggtcattgctctcacttgccttggcggctttgcctccccaggccctgtgcctccctct
acagccctcagggagctcattgaggagctggtcaacatcacccagaaccagaaggctccg
ctctgcaatggcagcatggtatggagcatcaacctgacagctggcatgtactgtgcagcc
ctggaatccctgatcaacgtgtcaggctgcagtgccatcgagaagacccagaggatgctg
agcggattctgcccgcacaaggtctcagctgggcagttttccagcttgcatgtccgagac
accaaaatcgaggtggcccagtttgtaaaggacctgctcttacatttaaagaaacttttt
cgcgagggacagttcaactga

DBGET integrated database retrieval system