KEGG   Homo sapiens (human): 3630Help
Entry
3630              CDS       T01001                                 

Gene name
INS, IDDM2, ILPR, IRDN, MODY10, IDDM1
Definition
insulin
Orthology
K04526  
insulin
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Oocyte meiosis
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Insulin secretion
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Maturity onset diabetes of the young
Aldosterone-regulated sodium reabsorption
Prostate cancer
Disease
H00408  
Type I diabetes mellitus
H00410  
Maturity onset diabetes of the young (MODY)
H00512  
Permanent neonatal diabetes mellitus (PNDM)
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:hsa04140]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:hsa04913]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:hsa04917]
Organismal Systems; Excretory system; Aldosterone-regulated sodium reabsorption [PATH:hsa04960]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:hsa04940]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
Human Diseases; Endocrine and metabolic diseases; Maturity onset diabetes of the young [PATH:hsa04950]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 110 aa AA seqDB search
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtggatgcgcctcctgcccctgctggcgctgctggccctctggggacctgac
ccagccgcagcctttgtgaaccaacacctgtgcggctcacacctggtggaagctctctac
ctagtgtgcggggaacgaggcttcttctacacacccaagacccgccgggaggcagaggac
ctgcaggtggggcaggtggagctgggcgggggccctggtgcaggcagcctgcagcccttg
gccctggaggggtccctgcagaagcgtggcattgtggaacaatgctgtaccagcatctgc
tccctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system