KEGG   Homo sapiens (human): 3630Help
Entry
3630              CDS       T01001                                 

Gene name
INS, IDDM, IDDM1, IDDM2, ILPR, IRDN, MODY10
Definition
(RefSeq) insulin
  KO
K04526  insulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04911  Insulin secretion
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04940  Type I diabetes mellitus
hsa04950  Maturity onset diabetes of the young
hsa04960  Aldosterone-regulated sodium reabsorption
hsa05215  Prostate cancer
Disease
H00408  Type I diabetes mellitus
H00410  Maturity onset diabetes of the young (MODY)
H00512  Permanent neonatal diabetes mellitus (PNDM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3630 (INS)
   04015 Rap1 signaling pathway
    3630 (INS)
   04010 MAPK signaling pathway
    3630 (INS)
   04066 HIF-1 signaling pathway
    3630 (INS)
   04068 FoxO signaling pathway
    3630 (INS)
   04072 Phospholipase D signaling pathway
    3630 (INS)
   04022 cGMP - PKG signaling pathway
    3630 (INS)
   04151 PI3K-Akt signaling pathway
    3630 (INS)
   04152 AMPK signaling pathway
    3630 (INS)
   04150 mTOR signaling pathway
    3630 (INS)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    3630 (INS)
  Cell growth and death
   04114 Oocyte meiosis
    3630 (INS)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3630 (INS)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    3630 (INS)
   04910 Insulin signaling pathway
    3630 (INS)
   04923 Regulation of lipolysis in adipocyte
    3630 (INS)
   04913 Ovarian Steroidogenesis
    3630 (INS)
   04914 Progesterone-mediated oocyte maturation
    3630 (INS)
   04917 Prolactin signaling pathway
    3630 (INS)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3630 (INS)
  Aging
   04211 Longevity regulating pathway - mammal
    3630 (INS)
   04213 Longevity regulating pathway - multiple species
    3630 (INS)
 Human Diseases
  Cancers
   05215 Prostate cancer
    3630 (INS)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    3630 (INS)
   04940 Type I diabetes mellitus
    3630 (INS)
   04950 Maturity onset diabetes of the young
    3630 (INS)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3630 (INS)
   04931 Insulin resistance
    3630 (INS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Insulin Ins_beta
Motif
Other DBs
NCBI-GeneID: 3630
NCBI-ProteinID: NP_000198
OMIM: 176730
HGNC: 6081
Ensembl: ENSG00000254647
Vega: OTTHUMG00000009558
Pharos: P01308(Tbio)
UniProt: P01308 I3WAC9
LinkDB All DBs
Structure
PDB: 
3W7Y 5E7W 5HQI 4FKA 3TT8 3W7Z 5USP 5UOZ 5URT 4AJX 5UU2 5HRQ 5USV 5UQA 5HPR 5UDP 5ENA 3EXX 2OMH 4CY7 4NIB 3W80 4EY1 4EY9 4EYD 5EN9 4XC4 4CXL 4P65 2WS6 2WRX 1ZEH 2OMG 4EYN 5BQQ 5T7R 4EXX 2WRU 4UNE 4F1B 4EYP 4IUZ 3ZU1 2WS1 3I3Z 3E7Y 1ZEG 1GUJ 4F4T 4F4V 4F51 4F1D 4F1G 4IYD 4EX1 4F0O 4F8F 4F1F 4F0N 5VIZ 5CO2 5CNY 5BOQ 4CXN 3ZI3 4F1C 3E7Z 2OLY 2OLZ 4RXW 5BTS 4GBC 4EWZ 5CO6 4IYF 4F1A 4AJZ 2VJZ 2CEU 1XDA 4UNG 3INC 3I40 4EX0 4GBN 5MT9 5BPO 3ZQR 3KQ6 2WS4 3ILG 1HTV 1TYL 1TYM 5CO9 2C8Q 1OS3 5UU4 3ZS2 2OM1 4EFX 3U4N 4FG3 3V19 3P2X 2W44 2R36 2QIU 1QIZ 1ZNJ 4AKJ 5MT3 3Q6E 2OM0 5USS 2R35 1W8P 2WS0 2WRV 5MAM 5HPU 4EWX 3V1G 3IR0 2VK0 2OMI 5UU3 2R34 1OS4 4AK0 5EMS 4EWW 3ROV 3P33 1QIY 1LPH 4GBK 1QJ0 5URU 2WRW 4GBI 4GBL 1B9E 2WS7 2WBY 4UNH 5WDM 2WC0 5CJO 4OGA 6BFC 6B70 6B3Q 3W11 4Q5Z 6CE9 3W12 3W13 6CEB 6CE7 5WBT 5MWQ 5MHD 2N2V 2N2W 2N2X 2MVC 2MVD 2MPI 2MPG 2MLI 2M2N 2M2O 2M2P 2M2M 2M1E 2LWZ 2LGB 2L1Y 2L1Z 2KXK 2KQQ 2KQP 2KJU 2KJJ 2K9R 2K91 2RN5 2JV1 2JMN 2HHO 2HH4 2H67 2C8R 1T0C 1UZ9 1SF1 1JCO 1IOG 1A7F 1SJT 1SJU 1AI0 1AIY 1VKT 1XGL 2HIU 1HUI 1HLS 1MHI 1MHJ 1HIQ 1HIS 1HIT
Thumbnails

Jmol
Position
11p15.5
AA seq 110 aa AA seqDB search
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtggatgcgcctcctgcccctgctggcgctgctggccctctggggacctgac
ccagccgcagcctttgtgaaccaacacctgtgcggctcacacctggtggaagctctctac
ctagtgtgcggggaacgaggcttcttctacacacccaagacccgccgggaggcagaggac
ctgcaggtggggcaggtggagctgggcgggggccctggtgcaggcagcctgcagcccttg
gccctggaggggtccctgcagaagcgtggcattgtggaacaatgctgtaccagcatctgc
tccctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system