KEGG   Homo sapiens (human): 3651Help
Entry
3651              CDS       T01001                                 

Gene name
PDX1, GSF, IDX-1, IPF1, IUF1, MODY4, PDX-1, STF-1
Definition
pancreatic and duodenal homeobox 1
Orthology
K07594  
insulin promoter factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Insulin secretion
Type II diabetes mellitus
Maturity onset diabetes of the young
Disease
H00410  
Maturity onset diabetes of the young (MODY)
H00512  
Permanent neonatal diabetes mellitus (PNDM)
H00861  
Pancreatic agenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    3651 (PDX1)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    3651 (PDX1)
   04950 Maturity onset diabetes of the young
    3651 (PDX1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Antp
    3651 (PDX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
13q12.1
AA seq 283 aa AA seqDB search
MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQG
SPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP
WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELA
VMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP
PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcgaggagcagtactacgcggccacgcagctttacaaggacccatgcgcgttc
cagcgaggcccggcgccggagttcagcgccagcccccctgcgtgcctgtacatgggccgc
cagcccccgccgccgccgccgcacccgttccctggcgccctgggcgcgctggagcagggc
agccccccggacatctccccgtacgaggtgccccccctcgccgacgaccccgcggtggcg
caccttcaccaccacctcccggctcagctcgcgctcccccacccgcccgccgggcccttc
ccggagggagccgagccgggcgtcctggaggagcccaaccgcgtccagctgcctttccca
tggatgaagtctaccaaagctcacgcgtggaaaggccagtgggcaggcggcgcctacgct
gcggagccggaggagaacaagcggacgcgcacggcctacacgcgcgcacagctgctagag
ctggagaaggagttcctattcaacaagtacatctcacggccgcgccgggtggagctggct
gtcatgttgaacttgaccgagagacacatcaagatctggttccaaaaccgccgcatgaag
tggaaaaaggaggaggacaagaagcgcggcggcgggacagctgtcgggggtggcggggtc
gcggagcctgagcaggactgcgccgtgacctccggcgaggagcttctggcgctgccgccg
ccgccgccccccggaggtgctgtgccgcccgctgcccccgttgccgcccgagagggccgc
ctgccgcctggccttagcgcgtcgccacagccctccagcgtcgcgcctcggcggccgcag
gaaccacgatga

DBGET integrated database retrieval system