KEGG   Homo sapiens (human): 3708Help
Entry
3708              CDS       T01001                                 

Gene name
ITPR1, ACV, CLA4, INSP3R1, IP3R, IP3R1, PPP1R94, SCA15, SCA16, SCA29
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  
inositol 1,4,5-triphosphate receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Autophagy - animal
Apoptosis
Cellular senescence
Vascular smooth muscle contraction
Apelin signaling pathway
Gap junction
Platelet activation
NOD-like receptor signaling pathway
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Estrogen signaling pathway
Thyroid hormone synthesis
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Kaposi's sarcoma-associated herpesvirus infection
Proteoglycans in cancer
Disease
H00063  
Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    3708 (ITPR1)
   04020 Calcium signaling pathway
    3708 (ITPR1)
   04070 Phosphatidylinositol signaling system
    3708 (ITPR1)
   04022 cGMP - PKG signaling pathway
    3708 (ITPR1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    3708 (ITPR1)
  Cell growth and death
   04114 Oocyte meiosis
    3708 (ITPR1)
   04210 Apoptosis
    3708 (ITPR1)
   04218 Cellular senescence
    3708 (ITPR1)
  Cellular community - eukaryotes
   04540 Gap junction
    3708 (ITPR1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    3708 (ITPR1)
   04621 NOD-like receptor signaling pathway
    3708 (ITPR1)
  Endocrine system
   04922 Glucagon signaling pathway
    3708 (ITPR1)
   04912 GnRH signaling pathway
    3708 (ITPR1)
   04915 Estrogen signaling pathway
    3708 (ITPR1)
   04921 Oxytocin signaling pathway
    3708 (ITPR1)
   04918 Thyroid hormone synthesis
    3708 (ITPR1)
   04924 Renin secretion
    3708 (ITPR1)
   04925 Aldosterone synthesis and secretion
    3708 (ITPR1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    3708 (ITPR1)
  Digestive system
   04970 Salivary secretion
    3708 (ITPR1)
   04971 Gastric acid secretion
    3708 (ITPR1)
   04972 Pancreatic secretion
    3708 (ITPR1)
  Nervous system
   04724 Glutamatergic synapse
    3708 (ITPR1)
   04725 Cholinergic synapse
    3708 (ITPR1)
   04728 Dopaminergic synapse
    3708 (ITPR1)
   04726 Serotonergic synapse
    3708 (ITPR1)
   04720 Long-term potentiation
    3708 (ITPR1)
   04730 Long-term depression
    3708 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    3708 (ITPR1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3708 (ITPR1)
  Environmental adaptation
   04713 Circadian entrainment
    3708 (ITPR1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    3708 (ITPR1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    3708 (ITPR1)
   05016 Huntington's disease
    3708 (ITPR1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    3708 (ITPR1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     3708 (ITPR1)
Ion channels [BR:hsa04040]
 Ryanodine and IP3 receptors
  IP3 receptor
   3708 (ITPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q14643(Tchem)
UniProt: 
LinkDB All DBs
Position
3p26.1
AA seq 2743 aa AA seqDB search
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDQDASRSRLRNAQEKMVYSLVSVPEGNDISSIFELDPTTL
RGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGTSPVKEDKEAFAIVPV
SPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVL
EVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRL
CYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEI
DTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPTNADILIETKLVLSRF
EFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAKEGQKEDRDVLSYYR
YQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRASFCRLMLHMHVDRDP
QEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEFVEEYLRDVVCQRFPF
SDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHVTTIFPISKMAKGEE
NKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEPEKEDI
MVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQEGPSNVP
GALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFR
HFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPDETMDG
ASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQQQRLL
RNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHINLFLNP
GILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIKK
CQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVELLAVCT
EGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYTSNH
MWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQTRQ
PVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLKS
HSIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQAELSVL
VDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLREMMTKD
RGYGEKLISIDELDNAELPPAPDSENATEELEPSPPLRQLEDHKRGEALRQVLVNRYYGN
VRPSGRRESLTSFGNGPLSAGGPGKPGGGGGGSGSSSMSRGEMSLAEVQCHLDKEGASNL
VIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMKVA
QQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAF
TTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNF
LRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTEYCQGP
CHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIMESRHDSE
NAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNVGHNIYILAHQLARHN
KELQSMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLRI
YYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVLM
NLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGIRALIASTILRLIFS
VGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFLYHLLYLVICAMGLF
VHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDF
ILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHT
CETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFG
VIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVL
VKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMK
LVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8232 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagcttcctacatattggagacatttgttctctgtacgcggag
ggatcgacaaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaaaccggggaccttaacaatccacctaagaaattcagagactgcctctttaagcta
tgtcccatgaaccgctactctgcccaaaagcagttctggaaagccgctaagcctggggcc
aacagcaccacagacgcagtgctactcaacaaactgcaccacgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtaatccagtatggcaatgtg
atccagctcctgcatttgaaaagtaataaatacctaacagtgaataagaggcttcctgct
ctgttggagaagaatgccatgagagtcacattggacgaggctggaaatgaagggtcctgg
ttttatattcagccattctacaagctgcgatccattggagacagcgtggtcataggtgac
aaggtggttctgaaccccgtcaatgctggtcagcccctacatgctagcagccatcaactg
gtagataacccaggctgcaatgaggtcaattccgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagacgacatattaaaggggggtgacgtggtg
aggctgtttcatgctgagcaggagaagtttctcacctgtgacgaacacaggaagaagcag
cacgtcttcctgagaaccacgggccggcagtcggccacatctgccaccagttcaaaagcc
ctgtgggaggtggaggtggtccagcatgacccatgtcggggcggagcagggtattggaac
agccttttccgtttcaagcatctggccacggggcattacttggcagcagaggtggaccct
gatcaggacgcctctcgaagtaggttgcggaatgcccaagaaaagatggtatactccctg
gtctctgtgcctgaaggcaatgacatctcctccattttcgagctagatcccaccactctg
cgtggaggtgacagccttgtcccaaggaactcttatgttcggctcagacacctatgtact
aatacctgggttcacagcacaaatattcctattgacaaggaagaagaaaagcccgtgatg
ctgaaaattggcacctctcctgtgaaggaggataaggaagcatttgccatagttccggtt
tctcctgctgaagttcgggacctggactttgccaatgatgccagcaaggtgctgggctcc
attgctgggaagctagagaagggcaccatcacccagaatgaaaggaggtctgtaaccaag
ctgctagaagatttggtttacttcgtcactggtggaactaattctggtcaagatgttctc
gaagttgtcttctccaagcccaacagagaacggcagaaactgatgagagaacagaatatt
ctcaagcagatcttcaagttgttacaagccccattcacagactgcggtgatggcccaatg
cttcggctggaagagctcggggaccagcggcacgctcctttcagacacatctgccggctc
tgctacagggtgctgagacactcgcagcaagactacaggaagaaccaggagtatatagcc
aagcagtttggcttcatgcagaagcagattggctatgatgtgttggctgaagacactatc
actgccctgctccacaataatcggaaactcctggaaaaacacattaccgcggcagagatt
gacacatttgtcagcctggtgcgaaagaacagggagcccagattcttagattacctctcc
gacctctgtgtctccatgaacaaatcaattccagtgacccaggaactgatatgtaaagct
gtgctgaaccccaccaacgctgacatcctgattgagaccaagttggttctttctcgtttt
gaatttgaaggtgtctcttccactggagagaatgctctggaggcaggagaagacgaggaa
gaggtgtggctgttttggagggacagcaacaaagagattcgcagcaagagtgtgagggaa
ttggctcaggatgctaaagaagggcagaaggaggaccgagacgttctcagctactacaga
tatcagctgaacctctttgcgaggatgtgtctggaccgccaatacctggccatcaacgaa
atctcaggccagctggatgtcgatctcattctccgctgcatgtctgacgagaacctgccc
tatgacctcagggcgtccttctgccgcctcatgcttcacatgcatgtggaccgagatccc
caggaacaagtcacccccgtgaaatatgcccgcctctggtcggagattccctcggagatc
gccattgacgactatgatagtagtggagcttccaaagatgaaattaaggagagatttgct
cagaccatggagtttgtggaggagtatttaagagatgtggtttgtcagaggttccctttc
tctgataaagagaagaataagcttacgtttgaggttgtaaatttagctaggaatctcata
tactttggtttctacaacttctctgaccttctacgattaactaagatccttctggccata
ttggactgtgtacatgtgacaacaatcttccccattagcaagatggcgaaaggagaagag
aataaaggtaacaatgatgtggagaagctgaagagcagtaacgtgatgagatctattcat
ggcgtgggagagctgatgacccaggtggtgctccggggaggaggctttttgcccatgact
cccatggctgctgcccctgaaggcaatgtgaagcaggcagagcctgagaaggaggacatc
atggtcatggacaccaagctgaagatcattgagatactccagtttattttgaatgtgagg
ttggattataggatctcctgcctcctgtgtatatttaagcgagagtttgatgaaagcaat
tcccagacttcagaaacatcctccggaaacagcagccaagaagggccaagtaatgtacca
ggtgctcttgactttgaacacattgaagaacaagcagaaggcatctttggaggaagtgag
gagaacaccccactggacttggatgaccacggcggcagaacctttctccgtgtcctgctc
cacttgacgatgcatgactacccacccctggtgtcaggggccctgcagctcctcttccgg
cacttcagccagaggcaggaggtgctccaggccttcaaacaggttcaactgctggttacc
agccaagatgtggacaactacaaacagatcaaacaagacttggatcaactgaggtccatc
gtggaaaagtcagagctttgggtgtacaaagggcagggccccgatgagactatggatggt
gcatctggagaaaatgaacataagaaaacggaggagggaaataacaagccacaaaagcat
gaaagcaccagcagctacaactacagagtggtcaaagagattttgattcggcttagcaaa
ctctgtgttcaagagagtgcctcagtgagaaagagcaggaagcagcaacagcgtctgctc
cggaacatgggcgcgcacgccgtggtgctggagctgctgcagattccctatgagaaggcc
gaagataccaagatgcaagagataatgaggttggctcatgaatttttgcagaatttctgc
gcaggcaaccagcagaatcaagctttgctacataaacacataaacctgtttctcaaccca
gggatcctggaggcagtaaccatgcagcacatcttcatgaacaatttccagctttgcagt
gagatcaacgagagagttgttcagcacttcgttcactgcatagagactcacggtcggaat
gtccagtatataaagttcttacagacaattgtcaaggcagaagggaaatttattaaaaaa
tgccaagacatggttatggccgagctggtcaattcgggagaggatgtcctcgtgttctac
aacgacagagcctctttccagactctgatccagatgatgcggtcagaacgggatcggatg
gatgagaacagccctctcatgtaccacatccacttggtcgagctcctggctgtgtgcacg
gagggtaagaatgtctacacagagatcaagtgcaactccctgctcccgctggatgacatc
gttcgcgtggtgacccacgaggactgcatccctgaggttaaaattgcatacattaacttc
ctgaatcactgctatgtggatacagaggtggaaatgaaggagatttataccagcaatcac
atgtggaaattgtttgagaatttccttgtagacatctgcagggcctgtaacaacactagt
gacaggaaacatgcagactcgattttggagaagtatgtcaccgaaatcgtcatgagtatt
gttactactttcttcagctctcccttctcagaccagagtacgactttgcagactcgccag
cctgtctttgtgcaactgctgcaaggcgtgttcagggtttaccactgcaactggttaatg
ccaagccaaaaagcctccgtggagagctgtattcgggtgctgtctgatgtagccaagagc
cgggccattgccattcccgtggacctggacagccaagtcaacaacctctttctcaagtcc
cacagcattgtgcagaaaacagccatgaactggcggctctcagcccgcaatgccgcacgc
agggactctgttctggcagcttccagagactaccggaatatcattgagagattgcaggac
atcgtctccgcgctggaggaccgtctcaggcccctggtgcaggcagagttatctgtgctc
gtggatgttctccacagacccgagctgcttttcccagagaacacagacgccagaaggaaa
tgtgaaagtggcggtttcatttgcaagttaataaagcatacaaaacagctgctagaagaa
aatgaagagaagctctgcattaaggtcctacagaccctgagggaaatgatgaccaaagat
agaggctatggagaaaagctaatttccattgatgaattggataatgctgagcttcctcca
gctccggattctgagaacgccactgaggagcttgaaccaagtccacccctgcggcagctg
gaagaccataaaaggggtgaggcgctcaggcaagttctggtcaaccgttactatggaaac
gtcagaccttcgggacgaagagagagccttaccagctttggcaatggcccactgtcagca
ggaggacccggcaagcccgggggaggagggggaggttccggatccagctctatgagcagg
ggtgagatgagtctggccgaggttcagtgtcaccttgacaaggagggggcttccaatcta
gttatcgacctcatcatgaacgcatccagtgaccgagtgttccatgaaagcattctcctg
gccattgcccttctggaaggaggcaacaccaccatccagcactcctttttctgtcgcttg
acagaagataagaagtcagagaaattctttaaggtgttttatgaccggatgaaggtggcc
cagcaagaaatcaaagcaacagtgacagtgaacaccagtgacttgggaaataaaaagaaa
gacgatgaggtagacagggatgccccatcacggaaaaaagctaaagagcccacaacacag
ataacagaagaggtccgggatcagctcctggaggcctccgctgccaccaggaaagccttc
accactttcaggagggaggctgatcccgacgaccactaccagcctggagagggcacccag
gccactgccgacaaggccaaggacgacctggagatgagcgcggtcatcaccatcatgcag
cccatcctccgcttccttcagctcctgtgtgaaaaccacaaccgagacctgcagaacttc
ctccgttgccaaaataacaagaccaactacaatttggtatgtgagaccctgcagtttctg
gactgtatttgtggaagcacaactggaggccttggtcttctgggcttgtatataaatgaa
aagaacgtagcgcttatcaaccaaaccctggaaagtctgaccgaatactgtcaaggacct
tgccatgagaaccagaactgcatagccacccatgaatccaatggcattgacatcatcaca
gccctgatcctcaatgatatcaatcctttgggaaagaagaggatggaccttgtgttagaa
ctgaagaacaatgcctcgaagttgctcctggccatcatggaaagcaggcacgacagtgaa
aacgcagagaggatactttataacatgaggcccaaggaactggtggaagtgatcaagaaa
gcctacatgcaaggtgaagtggaatttgaggatggagaaaacggtgaggatggggcggcg
tcccccaggaacgtggggcacaacatctacatattagcccatcagttggctcggcataac
aaagaacttcagagcatgctgaaacctggtggccaagtggacggagatgaagccctggag
ttttatgccaagcacacggcgcagatagagattgtcagattagaccgaacaatggaacag
atagtctttcccgtgcccagcatatgtgaattcctaaccaaggagtcaaaactacgaatt
tactatactacagagagagacgaacaaggcagcaaaatcaatgatttctttctgcggtct
gaagacctcttcaatgaaatgaattggcagaagaaactgagagcccagcccgtgttgtac
tggtgtgcccgcaacatgtctttctggagcagcatttcgtttaacctggccgtcctgatg
aacctgctggtggcgtttttctacccgtttaagggagtccgaggaggaaccctggagccc
cactggtcgggactcctgtggacagccatgctcatctctctggccatcgtcattgccctc
cccaagccccatggcatccgggccttaattgcctccacaattctacgactgatattttca
gtcgggttacaacccacgttgtttcttctgggcgctttcaatgtatgcaataaaatcatc
tttctaatgagctttgtgggcaactgtgggacattcacaagaggctaccgagccatggtt
ctggatgttgagttcctctatcatttgttgtatctggtgatctgtgccatggggctcttt
gtccatgaattcttctacagtctgctgctttttgatttagtgtacagagaagagactttg
cttaatgtcattaaaagtgtcactcgcaatggacggtccatcatcctgacagcagttctg
gctctgatcctcgtttacctgttctcaatagtgggctatcttttcttcaaggatgacttt
atcttggaagtagataggctgcccaatgaaacagctgttccagaaaccggcgagagtttg
gcaagcgagttcctgttctccgatgtgtgtagggtggagagtggggagaactgctcctct
cctgcacccagagaagagctggtccctgcagaagagacggaacaggataaagagcacaca
tgtgagacgctgctgatgtgcattgtcactgtgctgagtcacgggctgcggagcgggggt
ggagtaggagatgtactcaggaagccgtccaaagaggaacccctgtttgctgctagagtt
atttatgacctcttgttcttcttcatggtcatcatcattgttcttaacctgatttttggg
gttatcattgacacttttgctgacctgaggagtgagaagcagaagaaggaagagatcttg
aagaccacgtgctttatctgtggcttggaaagagacaagtttgacaacaagactgtcacc
tttgaagagcacatcaaggaagaacacaacatgtggcactatctgtgcttcatcgtcctg
gtgaaagtaaaggactccaccgaatatactgggcctgagagttacgtggcagaaatgatc
aaggaaagaaaccttgactggttccccaggatgagagccatgtcattggtcagcagtgat
tctgaaggagaacagaatgagctgagaaacctgcaggagaagctggagtccaccatgaaa
cttgtcacgaacctttctggccagctgtcggaattaaaggatcagatgacagaacaaagg
aagcagaaacaaagaattggtcttctaggacatcctcctcacatgaatgtcaacccacaa
caaccagcataa

DBGET integrated database retrieval system