KEGG   Homo sapiens (human): 3708Help
Entry
3708              CDS       T01001                                 

Gene name
ITPR1, ACV, CLA4, INSP3R1, IP3R, IP3R1, PPP1R94, SCA15, SCA16, SCA29
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing's syndrome
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05010  Alzheimer's disease
hsa05016  Huntington's disease
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05205  Proteoglycans in cancer
Disease
H00063  Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    3708 (ITPR1)
   04020 Calcium signaling pathway
    3708 (ITPR1)
   04070 Phosphatidylinositol signaling system
    3708 (ITPR1)
   04022 cGMP - PKG signaling pathway
    3708 (ITPR1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    3708 (ITPR1)
  Cell growth and death
   04114 Oocyte meiosis
    3708 (ITPR1)
   04210 Apoptosis
    3708 (ITPR1)
   04218 Cellular senescence
    3708 (ITPR1)
  Cellular community - eukaryotes
   04540 Gap junction
    3708 (ITPR1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    3708 (ITPR1)
   04621 NOD-like receptor signaling pathway
    3708 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    3708 (ITPR1)
  Endocrine system
   04922 Glucagon signaling pathway
    3708 (ITPR1)
   04912 GnRH signaling pathway
    3708 (ITPR1)
   04915 Estrogen signaling pathway
    3708 (ITPR1)
   04921 Oxytocin signaling pathway
    3708 (ITPR1)
   04918 Thyroid hormone synthesis
    3708 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    3708 (ITPR1)
   04924 Renin secretion
    3708 (ITPR1)
   04925 Aldosterone synthesis and secretion
    3708 (ITPR1)
   04927 Cortisol synthesis and secretion
    3708 (ITPR1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    3708 (ITPR1)
  Digestive system
   04970 Salivary secretion
    3708 (ITPR1)
   04971 Gastric acid secretion
    3708 (ITPR1)
   04972 Pancreatic secretion
    3708 (ITPR1)
  Nervous system
   04724 Glutamatergic synapse
    3708 (ITPR1)
   04725 Cholinergic synapse
    3708 (ITPR1)
   04728 Dopaminergic synapse
    3708 (ITPR1)
   04726 Serotonergic synapse
    3708 (ITPR1)
   04720 Long-term potentiation
    3708 (ITPR1)
   04730 Long-term depression
    3708 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    3708 (ITPR1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3708 (ITPR1)
  Environmental adaptation
   04713 Circadian entrainment
    3708 (ITPR1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    3708 (ITPR1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    3708 (ITPR1)
   05016 Huntington's disease
    3708 (ITPR1)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    3708 (ITPR1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    3708 (ITPR1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     3708 (ITPR1)
Ion channels [BR:hsa04040]
 Ryanodine and IP3 receptors
  IP3 receptor
   3708 (ITPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec MIR RYDR_ITPR RIH_assoc Ion_trans
Motif
Other DBs
NCBI-GeneID: 3708
NCBI-ProteinID: NP_001161744
OMIM: 147265
HGNC: 6180
Ensembl: ENSG00000150995
Vega: OTTHUMG00000154996
Pharos: Q14643(Tchem)
UniProt: Q14643
LinkDB All DBs
Position
3p26.1
AA seq 2743 aa AA seqDB search
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDQDASRSRLRNAQEKMVYSLVSVPEGNDISSIFELDPTTL
RGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGTSPVKEDKEAFAIVPV
SPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVL
EVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRL
CYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEI
DTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPTNADILIETKLVLSRF
EFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAKEGQKEDRDVLSYYR
YQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRASFCRLMLHMHVDRDP
QEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEFVEEYLRDVVCQRFPF
SDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHVTTIFPISKMAKGEE
NKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEPEKEDI
MVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQEGPSNVP
GALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFR
HFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPDETMDG
ASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQQQRLL
RNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHINLFLNP
GILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIKK
CQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVELLAVCT
EGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYTSNH
MWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQTRQ
PVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLKS
HSIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQAELSVL
VDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLREMMTKD
RGYGEKLISIDELDNAELPPAPDSENATEELEPSPPLRQLEDHKRGEALRQVLVNRYYGN
VRPSGRRESLTSFGNGPLSAGGPGKPGGGGGGSGSSSMSRGEMSLAEVQCHLDKEGASNL
VIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMKVA
QQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAF
TTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNF
LRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTEYCQGP
CHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIMESRHDSE
NAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNVGHNIYILAHQLARHN
KELQSMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLRI
YYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVLM
NLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGIRALIASTILRLIFS
VGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFLYHLLYLVICAMGLF
VHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDF
ILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHT
CETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFG
VIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVL
VKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMK
LVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8232 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagcttcctacatattggagacatttgttctctgtacgcggag
ggatcgacaaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaaaccggggaccttaacaatccacctaagaaattcagagactgcctctttaagcta
tgtcccatgaaccgctactctgcccaaaagcagttctggaaagccgctaagcctggggcc
aacagcaccacagacgcagtgctactcaacaaactgcaccacgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtaatccagtatggcaatgtg
atccagctcctgcatttgaaaagtaataaatacctaacagtgaataagaggcttcctgct
ctgttggagaagaatgccatgagagtcacattggacgaggctggaaatgaagggtcctgg
ttttatattcagccattctacaagctgcgatccattggagacagcgtggtcataggtgac
aaggtggttctgaaccccgtcaatgctggtcagcccctacatgctagcagccatcaactg
gtagataacccaggctgcaatgaggtcaattccgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagacgacatattaaaggggggtgacgtggtg
aggctgtttcatgctgagcaggagaagtttctcacctgtgacgaacacaggaagaagcag
cacgtcttcctgagaaccacgggccggcagtcggccacatctgccaccagttcaaaagcc
ctgtgggaggtggaggtggtccagcatgacccatgtcggggcggagcagggtattggaac
agccttttccgtttcaagcatctggccacggggcattacttggcagcagaggtggaccct
gatcaggacgcctctcgaagtaggttgcggaatgcccaagaaaagatggtatactccctg
gtctctgtgcctgaaggcaatgacatctcctccattttcgagctagatcccaccactctg
cgtggaggtgacagccttgtcccaaggaactcttatgttcggctcagacacctatgtact
aatacctgggttcacagcacaaatattcctattgacaaggaagaagaaaagcccgtgatg
ctgaaaattggcacctctcctgtgaaggaggataaggaagcatttgccatagttccggtt
tctcctgctgaagttcgggacctggactttgccaatgatgccagcaaggtgctgggctcc
attgctgggaagctagagaagggcaccatcacccagaatgaaaggaggtctgtaaccaag
ctgctagaagatttggtttacttcgtcactggtggaactaattctggtcaagatgttctc
gaagttgtcttctccaagcccaacagagaacggcagaaactgatgagagaacagaatatt
ctcaagcagatcttcaagttgttacaagccccattcacagactgcggtgatggcccaatg
cttcggctggaagagctcggggaccagcggcacgctcctttcagacacatctgccggctc
tgctacagggtgctgagacactcgcagcaagactacaggaagaaccaggagtatatagcc
aagcagtttggcttcatgcagaagcagattggctatgatgtgttggctgaagacactatc
actgccctgctccacaataatcggaaactcctggaaaaacacattaccgcggcagagatt
gacacatttgtcagcctggtgcgaaagaacagggagcccagattcttagattacctctcc
gacctctgtgtctccatgaacaaatcaattccagtgacccaggaactgatatgtaaagct
gtgctgaaccccaccaacgctgacatcctgattgagaccaagttggttctttctcgtttt
gaatttgaaggtgtctcttccactggagagaatgctctggaggcaggagaagacgaggaa
gaggtgtggctgttttggagggacagcaacaaagagattcgcagcaagagtgtgagggaa
ttggctcaggatgctaaagaagggcagaaggaggaccgagacgttctcagctactacaga
tatcagctgaacctctttgcgaggatgtgtctggaccgccaatacctggccatcaacgaa
atctcaggccagctggatgtcgatctcattctccgctgcatgtctgacgagaacctgccc
tatgacctcagggcgtccttctgccgcctcatgcttcacatgcatgtggaccgagatccc
caggaacaagtcacccccgtgaaatatgcccgcctctggtcggagattccctcggagatc
gccattgacgactatgatagtagtggagcttccaaagatgaaattaaggagagatttgct
cagaccatggagtttgtggaggagtatttaagagatgtggtttgtcagaggttccctttc
tctgataaagagaagaataagcttacgtttgaggttgtaaatttagctaggaatctcata
tactttggtttctacaacttctctgaccttctacgattaactaagatccttctggccata
ttggactgtgtacatgtgacaacaatcttccccattagcaagatggcgaaaggagaagag
aataaaggtaacaatgatgtggagaagctgaagagcagtaacgtgatgagatctattcat
ggcgtgggagagctgatgacccaggtggtgctccggggaggaggctttttgcccatgact
cccatggctgctgcccctgaaggcaatgtgaagcaggcagagcctgagaaggaggacatc
atggtcatggacaccaagctgaagatcattgagatactccagtttattttgaatgtgagg
ttggattataggatctcctgcctcctgtgtatatttaagcgagagtttgatgaaagcaat
tcccagacttcagaaacatcctccggaaacagcagccaagaagggccaagtaatgtacca
ggtgctcttgactttgaacacattgaagaacaagcagaaggcatctttggaggaagtgag
gagaacaccccactggacttggatgaccacggcggcagaacctttctccgtgtcctgctc
cacttgacgatgcatgactacccacccctggtgtcaggggccctgcagctcctcttccgg
cacttcagccagaggcaggaggtgctccaggccttcaaacaggttcaactgctggttacc
agccaagatgtggacaactacaaacagatcaaacaagacttggatcaactgaggtccatc
gtggaaaagtcagagctttgggtgtacaaagggcagggccccgatgagactatggatggt
gcatctggagaaaatgaacataagaaaacggaggagggaaataacaagccacaaaagcat
gaaagcaccagcagctacaactacagagtggtcaaagagattttgattcggcttagcaaa
ctctgtgttcaagagagtgcctcagtgagaaagagcaggaagcagcaacagcgtctgctc
cggaacatgggcgcgcacgccgtggtgctggagctgctgcagattccctatgagaaggcc
gaagataccaagatgcaagagataatgaggttggctcatgaatttttgcagaatttctgc
gcaggcaaccagcagaatcaagctttgctacataaacacataaacctgtttctcaaccca
gggatcctggaggcagtaaccatgcagcacatcttcatgaacaatttccagctttgcagt
gagatcaacgagagagttgttcagcacttcgttcactgcatagagactcacggtcggaat
gtccagtatataaagttcttacagacaattgtcaaggcagaagggaaatttattaaaaaa
tgccaagacatggttatggccgagctggtcaattcgggagaggatgtcctcgtgttctac
aacgacagagcctctttccagactctgatccagatgatgcggtcagaacgggatcggatg
gatgagaacagccctctcatgtaccacatccacttggtcgagctcctggctgtgtgcacg
gagggtaagaatgtctacacagagatcaagtgcaactccctgctcccgctggatgacatc
gttcgcgtggtgacccacgaggactgcatccctgaggttaaaattgcatacattaacttc
ctgaatcactgctatgtggatacagaggtggaaatgaaggagatttataccagcaatcac
atgtggaaattgtttgagaatttccttgtagacatctgcagggcctgtaacaacactagt
gacaggaaacatgcagactcgattttggagaagtatgtcaccgaaatcgtcatgagtatt
gttactactttcttcagctctcccttctcagaccagagtacgactttgcagactcgccag
cctgtctttgtgcaactgctgcaaggcgtgttcagggtttaccactgcaactggttaatg
ccaagccaaaaagcctccgtggagagctgtattcgggtgctgtctgatgtagccaagagc
cgggccattgccattcccgtggacctggacagccaagtcaacaacctctttctcaagtcc
cacagcattgtgcagaaaacagccatgaactggcggctctcagcccgcaatgccgcacgc
agggactctgttctggcagcttccagagactaccggaatatcattgagagattgcaggac
atcgtctccgcgctggaggaccgtctcaggcccctggtgcaggcagagttatctgtgctc
gtggatgttctccacagacccgagctgcttttcccagagaacacagacgccagaaggaaa
tgtgaaagtggcggtttcatttgcaagttaataaagcatacaaaacagctgctagaagaa
aatgaagagaagctctgcattaaggtcctacagaccctgagggaaatgatgaccaaagat
agaggctatggagaaaagctaatttccattgatgaattggataatgctgagcttcctcca
gctccggattctgagaacgccactgaggagcttgaaccaagtccacccctgcggcagctg
gaagaccataaaaggggtgaggcgctcaggcaagttctggtcaaccgttactatggaaac
gtcagaccttcgggacgaagagagagccttaccagctttggcaatggcccactgtcagca
ggaggacccggcaagcccgggggaggagggggaggttccggatccagctctatgagcagg
ggtgagatgagtctggccgaggttcagtgtcaccttgacaaggagggggcttccaatcta
gttatcgacctcatcatgaacgcatccagtgaccgagtgttccatgaaagcattctcctg
gccattgcccttctggaaggaggcaacaccaccatccagcactcctttttctgtcgcttg
acagaagataagaagtcagagaaattctttaaggtgttttatgaccggatgaaggtggcc
cagcaagaaatcaaagcaacagtgacagtgaacaccagtgacttgggaaataaaaagaaa
gacgatgaggtagacagggatgccccatcacggaaaaaagctaaagagcccacaacacag
ataacagaagaggtccgggatcagctcctggaggcctccgctgccaccaggaaagccttc
accactttcaggagggaggctgatcccgacgaccactaccagcctggagagggcacccag
gccactgccgacaaggccaaggacgacctggagatgagcgcggtcatcaccatcatgcag
cccatcctccgcttccttcagctcctgtgtgaaaaccacaaccgagacctgcagaacttc
ctccgttgccaaaataacaagaccaactacaatttggtatgtgagaccctgcagtttctg
gactgtatttgtggaagcacaactggaggccttggtcttctgggcttgtatataaatgaa
aagaacgtagcgcttatcaaccaaaccctggaaagtctgaccgaatactgtcaaggacct
tgccatgagaaccagaactgcatagccacccatgaatccaatggcattgacatcatcaca
gccctgatcctcaatgatatcaatcctttgggaaagaagaggatggaccttgtgttagaa
ctgaagaacaatgcctcgaagttgctcctggccatcatggaaagcaggcacgacagtgaa
aacgcagagaggatactttataacatgaggcccaaggaactggtggaagtgatcaagaaa
gcctacatgcaaggtgaagtggaatttgaggatggagaaaacggtgaggatggggcggcg
tcccccaggaacgtggggcacaacatctacatattagcccatcagttggctcggcataac
aaagaacttcagagcatgctgaaacctggtggccaagtggacggagatgaagccctggag
ttttatgccaagcacacggcgcagatagagattgtcagattagaccgaacaatggaacag
atagtctttcccgtgcccagcatatgtgaattcctaaccaaggagtcaaaactacgaatt
tactatactacagagagagacgaacaaggcagcaaaatcaatgatttctttctgcggtct
gaagacctcttcaatgaaatgaattggcagaagaaactgagagcccagcccgtgttgtac
tggtgtgcccgcaacatgtctttctggagcagcatttcgtttaacctggccgtcctgatg
aacctgctggtggcgtttttctacccgtttaagggagtccgaggaggaaccctggagccc
cactggtcgggactcctgtggacagccatgctcatctctctggccatcgtcattgccctc
cccaagccccatggcatccgggccttaattgcctccacaattctacgactgatattttca
gtcgggttacaacccacgttgtttcttctgggcgctttcaatgtatgcaataaaatcatc
tttctaatgagctttgtgggcaactgtgggacattcacaagaggctaccgagccatggtt
ctggatgttgagttcctctatcatttgttgtatctggtgatctgtgccatggggctcttt
gtccatgaattcttctacagtctgctgctttttgatttagtgtacagagaagagactttg
cttaatgtcattaaaagtgtcactcgcaatggacggtccatcatcctgacagcagttctg
gctctgatcctcgtttacctgttctcaatagtgggctatcttttcttcaaggatgacttt
atcttggaagtagataggctgcccaatgaaacagctgttccagaaaccggcgagagtttg
gcaagcgagttcctgttctccgatgtgtgtagggtggagagtggggagaactgctcctct
cctgcacccagagaagagctggtccctgcagaagagacggaacaggataaagagcacaca
tgtgagacgctgctgatgtgcattgtcactgtgctgagtcacgggctgcggagcgggggt
ggagtaggagatgtactcaggaagccgtccaaagaggaacccctgtttgctgctagagtt
atttatgacctcttgttcttcttcatggtcatcatcattgttcttaacctgatttttggg
gttatcattgacacttttgctgacctgaggagtgagaagcagaagaaggaagagatcttg
aagaccacgtgctttatctgtggcttggaaagagacaagtttgacaacaagactgtcacc
tttgaagagcacatcaaggaagaacacaacatgtggcactatctgtgcttcatcgtcctg
gtgaaagtaaaggactccaccgaatatactgggcctgagagttacgtggcagaaatgatc
aaggaaagaaaccttgactggttccccaggatgagagccatgtcattggtcagcagtgat
tctgaaggagaacagaatgagctgagaaacctgcaggagaagctggagtccaccatgaaa
cttgtcacgaacctttctggccagctgtcggaattaaaggatcagatgacagaacaaagg
aagcagaaacaaagaattggtcttctaggacatcctcctcacatgaatgtcaacccacaa
caaccagcataa

DBGET integrated database retrieval system