KEGG   Homo sapiens (human): 3732Help
Entry
3732              CDS       T01001                                 

Gene name
CD82, 4F9, C33, GR15, IA4, KAI1, R2, SAR2, ST6, TSPAN27
Definition
CD82 molecule
Orthology
K06509  
CD82 antigen
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    3732 (CD82)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3732 (CD82)
  Exosomal proteins of other body fluids (saliva and urine)
   3732 (CD82)
  Exosomal proteins of colorectal cancer cells
   3732 (CD82)
Cellular antigens [BR:hsa04090]
 Proteins
  3732 (CD82)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
LinkDB All DBs
Position
11p11.2
AA seq 242 aa AA seqDB search
MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFI
GVGAVTMLMGFLGCIGAVNEVRCLLGLLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQA
QVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNH
PEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVP
KY
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgggctcagcctgtatcaaagtcaccaaatactttctcttcctcttcaacttgatcttc
tttatcctgggcgcagtgatcctgggcttcggggtgtggatcctggccgacaagagcagt
ttcatctctgtcctgcaaacctcctccagctcgcttaggatgggggcctatgtcttcatc
ggcgtgggggcagtcactatgctcatgggcttcctgggctgcatcggcgccgtcaacgag
gtccgctgcctgctggggctgctgaagcaggagatgggcggcatcgtgactgagctcatt
cgagactacaacagcagtcgcgaggacagcctgcaggatgcctgggactacgtgcaggct
caggtgaagtgctgcggctgggtcagcttctacaactggacagacaacgctgagctcatg
aatcgccctgaggtcacctacccctgttcctgcgaagtcaagggggaagaggacaacagc
ctttctgtgaggaagggcttctgcgaggcccccggcaacaggacccagagtggcaaccac
cctgaggactggcctgtgtaccaggagggctgcatggagaaggtgcaggcgtggctgcag
gagaacctgggcatcatcctcggcgtgggcgtgggtgtggccatcatcgagctcctgggg
atggtcctgtccatctgcttgtgccggcacgtccattccgaagactacagcaaggtcccc
aagtactga

DBGET integrated database retrieval system