KEGG   Homo sapiens (human): 3815Help
Entry
3815              CDS       T01001                                 

Gene name
KIT, C-Kit, CD117, PBT, SCFR
Definition
v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (EC:2.7.10.1)
Orthology
K05091  
proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Hematopoietic cell lineage
Melanogenesis
Pathways in cancer
Acute myeloid leukemia
Disease
H00003  
Acute myeloid leukemia (AML)
H00170  
Piebaldism
H01359  
Anaphylaxis
Drug target
Imatinib: 
Sunitinib: 
Sorafenib: 
Dasatinib: 
Nilotinib: 
Pazopanib: 
Axitinib: 
Masitinib: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3815 (KIT)
   04015 Rap1 signaling pathway
    3815 (KIT)
   04151 PI3K-Akt signaling pathway
    3815 (KIT)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3815 (KIT)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3815 (KIT)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3815 (KIT)
  Endocrine system
   04916 Melanogenesis
    3815 (KIT)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3815 (KIT)
   05221 Acute myeloid leukemia
    3815 (KIT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     3815 (KIT)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   3815 (KIT)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   3815 (KIT)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   3815 (KIT)
Cellular antigens [BR:hsa04090]
 Proteins
  3815 (KIT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4q12
AA seq 976 aa AA seqDB search
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggattttctctgcgttctgctcctactgcttcgcgtc
cagacaggctcttctcaaccatctgtgagtccaggggaaccgtctccaccatccatccat
ccaggaaaatcagacttaatagtccgcgtgggcgacgagattaggctgttatgcactgat
ccgggctttgtcaaatggacttttgagatcctggatgaaacgaatgagaataagcagaat
gaatggatcacggaaaaggcagaagccaccaacaccggcaaatacacgtgcaccaacaaa
cacggcttaagcaattccatttatgtgtttgttagagatcctgccaagcttttccttgtt
gaccgctccttgtatgggaaagaagacaacgacacgctggtccgctgtcctctcacagac
ccagaagtgaccaattattccctcaaggggtgccaggggaagcctcttcccaaggacttg
aggtttattcctgaccccaaggcgggcatcatgatcaaaagtgtgaaacgcgcctaccat
cggctctgtctgcattgttctgtggaccaggagggcaagtcagtgctgtcggaaaaattc
atcctgaaagtgaggccagccttcaaagctgtgcctgttgtgtctgtgtccaaagcaagc
tatcttcttagggaaggggaagaattcacagtgacgtgcacaataaaagatgtgtctagt
tctgtgtactcaacgtggaaaagagaaaacagtcagactaaactacaggagaaatataat
agctggcatcacggtgacttcaattatgaacgtcaggcaacgttgactatcagttcagcg
agagttaatgattctggagtgttcatgtgttatgccaataatacttttggatcagcaaat
gtcacaacaaccttggaagtagtagataaaggattcattaatatcttccccatgataaac
actacagtatttgtaaacgatggagaaaatgtagatttgattgttgaatatgaagcattc
cccaaacctgaacaccagcagtggatctatatgaacagaaccttcactgataaatgggaa
gattatcccaagtctgagaatgaaagtaatatcagatacgtaagtgaacttcatctaacg
agattaaaaggcaccgaaggaggcacttacacattcctagtgtccaattctgacgtcaat
gctgccatagcatttaatgtttatgtgaatacaaaaccagaaatcctgacttacgacagg
ctcgtgaatggcatgctccaatgtgtggcagcaggattcccagagcccacaatagattgg
tatttttgtccaggaactgagcagagatgctctgcttctgtactgccagtggatgtgcag
acactaaactcatctgggccaccgtttggaaagctagtggttcagagttctatagattct
agtgcattcaagcacaatggcacggttgaatgtaaggcttacaacgatgtgggcaagact
tctgcctattttaactttgcatttaaaggtaacaacaaagagcaaatccatccccacacc
ctgttcactcctttgctgattggtttcgtaatcgtagctggcatgatgtgcattattgtg
atgattctgacctacaaatatttacagaaacccatgtatgaagtacagtggaaggttgtt
gaggagataaatggaaacaattatgtttacatagacccaacacaacttccttatgatcac
aaatgggagtttcccagaaacaggctgagttttgggaaaaccctgggtgctggagctttc
gggaaggttgttgaggcaactgcttatggcttaattaagtcagatgcggccatgactgtc
gctgtaaagatgctcaagccgagtgcccatttgacagaacgggaagccctcatgtctgaa
ctcaaagtcctgagttaccttggtaatcacatgaatattgtgaatctacttggagcctgc
accattggagggcccaccctggtcattacagaatattgttgctatggtgatcttttgaat
tttttgagaagaaaacgtgattcatttatttgttcaaagcaggaagatcatgcagaagct
gcactttataagaatcttctgcattcaaaggagtcttcctgcagcgatagtactaatgag
tacatggacatgaaacctggagtttcttatgttgtcccaaccaaggccgacaaaaggaga
tctgtgagaataggctcatacatagaaagagatgtgactcccgccatcatggaggatgac
gagttggccctagacttagaagacttgctgagcttttcttaccaggtggcaaagggcatg
gctttcctcgcctccaagaattgtattcacagagacttggcagccagaaatatcctcctt
actcatggtcggatcacaaagatttgtgattttggtctagccagagacatcaagaatgat
tctaattatgtggttaaaggaaacgctcgactacctgtgaagtggatggcacctgaaagc
attttcaactgtgtatacacgtttgaaagtgacgtctggtcctatgggatttttctttgg
gagctgttctctttaggaagcagcccctatcctggaatgccggtcgattctaagttctac
aagatgatcaaggaaggcttccggatgctcagccctgaacacgcacctgctgaaatgtat
gacataatgaagacttgctgggatgcagatcccctaaaaagaccaacattcaagcaaatt
gttcagctaattgagaagcagatttcagagagcaccaatcatatttactccaacttagca
aactgcagccccaaccgacagaagcccgtggtagaccattctgtgcggatcaattctgtc
ggcagcaccgcttcctcctcccagcctctgcttgtgcacgacgatgtctga

DBGET integrated database retrieval system