KEGG   Homo sapiens (human): 3858Help
Entry
3858              CDS       T01001                                 

Gene name
KRT10, BCIE, BIE, CK10, EHK, K10, KPP
Definition
keratin 10
Orthology
K07604  
type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
Staphylococcus aureus infection
Disease
H00691  
Epidermolytic hyperkeratosis (EHK)
H00738  
Ichthyosis with confetti
Class
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
17q21
AA seq 584 aa AA seqDB search
MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRG
SSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGG
GFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKE
WYEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYEN
EVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTG
DVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISS
YKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQ
IRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGG
GSSGGGHGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGG
GYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcgatacagctcaagcaagcactactcttcctcccgcagtggaggaggagga
ggaggaggaggatgtggaggaggaggaggagtgtcatccctaagaatttctagcagcaaa
ggctcccttggtggaggatttagctcaggggggttcagtggtggctcttttagccgtggg
agctctggtgggggctgctttgggggctcatcaggtggctatggaggattaggaggtttt
ggtggaggtagctttcgtggaagctatggaagtagcagctttggtgggagttatggaggc
agctttggagggggcagtttcggaggtggcagctttggtgggggcagctttggtggaggc
ggctttggtggaggcggctttggaggaggctttggtggtggatttggaggagatggtggc
cttctctctggaaatgaaaaagtaaccatgcagaatctgaatgaccgcctggcttcctac
ttggacaaagttcgggctctggaagaatcaaactatgagctggaaggcaaaatcaaggag
tggtatgaaaagcatggcaactcacatcagggggagcctcgtgactacagcaaatactac
aaaaccatcgatgaccttaaaaatcagattctcaacctaacaactgataatgccaacatc
ctgcttcagatcgacaatgccaggctggcagctgatgacttcaggctgaagtatgagaat
gaggtagctctgcgccagagcgtggaggctgacatcaacggcctgcgtagggtgctggat
gagctgaccctgaccaaggctgacctggagatgcaaattgagagcctgactgaagagctg
gcctatctgaagaagaaccacgaggaggaaatgaaagaccttcgaaatgtgtccactggt
gatgtgaatgtggaaatgaatgctgccccgggtgttgatctgactcaacttctgaataac
atgagaagccaatatgaacaacttgctgaacaaaaccgcaaagatgctgaagcctggttc
aatgaaaagagcaaggaactgactacagaaattgataataacattgaacagatatccagc
tataaatctgagattactgaattgagacgtaatgtacaagctctggagatagaactacag
tcccaactggccttgaaacaatccctggaagcctccttggcagaaacagaaggtcgctac
tgtgtgcagctctcacagattcaggcccagatatccgctctggaagaacagttgcaacag
attcgagctgaaaccgagtgccagaatactgaataccaacaactcctggatattaagatc
cgactggagaatgaaattcaaacctaccgcagcctgctagaaggagagggaagttccgga
ggcggcggacgcggcggcggaagtttcggcggcggctacggcggcggaagctccggcggc
ggaagctccggcggcggccacggcggcggccacggcggcagttccggcggcggctacgga
ggcggaagctccggcggcggaagctccggcggcggctacgggggcggaagctccagcggc
ggccacggcggcagttccagcggcggctacggtggtggcagttccggcggcggcggcggc
ggctacgggggcggcagctccggcggcggcagcagctccggcggcggatacggcggcggc
agctccagcggaggccacaagtcctcctcttccgggtccgtgggcgagtcttcatctaag
ggaccaagatactaa

DBGET integrated database retrieval system