KEGG   Homo sapiens (human): 3858Help
Entry
3858              CDS       T01001                                 

Gene name
KRT10, BCIE, BIE, CK10, EHK, K10, KPP
Definition
keratin 10
Orthology
K07604  
type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
Staphylococcus aureus infection
Disease
H00691  
Epidermolytic hyperkeratosis (EHK)
H00738  
Ichthyosis with confetti
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    3858 (KRT10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3858 (KRT10)
  Exosomal proteins of other body fluids (saliva and urine)
   3858 (KRT10)
  Exosomal proteins of colorectal cancer cells
   3858 (KRT10)
  Exosomal proteins of melanoma cells
   3858 (KRT10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
17q21
AA seq 584 aa AA seqDB search
MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRG
SSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGG
GFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKE
WYEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYEN
EVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTG
DVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISS
YKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQ
IRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGG
GSSGGGHGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGG
GYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcgatacagctcaagcaagcactactcttcctcccgcagtggaggaggagga
ggaggaggaggatgtggaggaggaggaggagtgtcatccctaagaatttctagcagcaaa
ggctcccttggtggaggatttagctcaggggggttcagtggtggctcttttagccgtggg
agctctggtgggggctgctttgggggctcatcaggtggctatggaggattaggaggtttt
ggtggaggtagctttcgtggaagctatggaagtagcagctttggtgggagttatggaggc
agctttggagggggcagtttcggaggtggcagctttggtgggggcagctttggtggaggc
ggctttggtggaggcggctttggaggaggctttggtggtggatttggaggagatggtggc
cttctctctggaaatgaaaaagtaaccatgcagaatctgaatgaccgcctggcttcctac
ttggacaaagttcgggctctggaagaatcaaactatgagctggaaggcaaaatcaaggag
tggtatgaaaagcatggcaactcacatcagggggagcctcgtgactacagcaaatactac
aaaaccatcgatgaccttaaaaatcagattctcaacctaacaactgataatgccaacatc
ctgcttcagatcgacaatgccaggctggcagctgatgacttcaggctgaagtatgagaat
gaggtagctctgcgccagagcgtggaggctgacatcaacggcctgcgtagggtgctggat
gagctgaccctgaccaaggctgacctggagatgcaaattgagagcctgactgaagagctg
gcctatctgaagaagaaccacgaggaggaaatgaaagaccttcgaaatgtgtccactggt
gatgtgaatgtggaaatgaatgctgccccgggtgttgatctgactcaacttctgaataac
atgagaagccaatatgaacaacttgctgaacaaaaccgcaaagatgctgaagcctggttc
aatgaaaagagcaaggaactgactacagaaattgataataacattgaacagatatccagc
tataaatctgagattactgaattgagacgtaatgtacaagctctggagatagaactacag
tcccaactggccttgaaacaatccctggaagcctccttggcagaaacagaaggtcgctac
tgtgtgcagctctcacagattcaggcccagatatccgctctggaagaacagttgcaacag
attcgagctgaaaccgagtgccagaatactgaataccaacaactcctggatattaagatc
cgactggagaatgaaattcaaacctaccgcagcctgctagaaggagagggaagttccgga
ggcggcggacgcggcggcggaagtttcggcggcggctacggcggcggaagctccggcggc
ggaagctccggcggcggccacggcggcggccacggcggcagttccggcggcggctacgga
ggcggaagctccggcggcggaagctccggcggcggctacgggggcggaagctccagcggc
ggccacggcggcagttccagcggcggctacggtggtggcagttccggcggcggcggcggc
ggctacgggggcggcagctccggcggcggcagcagctccggcggcggatacggcggcggc
agctccagcggaggccacaagtcctcctcttccgggtccgtgggcgagtcttcatctaag
ggaccaagatactaa

DBGET integrated database retrieval system