KEGG   Homo sapiens (human): 3875Help
Entry
3875              CDS       T01001                                 

Gene name
KRT18, CYK18, K18
Definition
keratin 18
Orthology
K07604  
type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
Pathogenic Escherichia coli infection
Class
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12q13
AA seq 430 aa AA seqDB search
MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGS
GGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKG
PQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVEN
DIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAP
KSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELR
RTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQA
QEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVS
ETNDTKVLRH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaccactcgctccaccttctccaccaactaccggtccctgggctctgtccag
gcgcccagctacggcgcccggccggtcagcagcgcggccagcgtctatgcaggcgctggg
ggctctggttcccggatctccgtgtcccgctccaccagcttcaggggcggcatggggtcc
gggggcctggccaccgggatagccgggggtctggcaggaatgggaggcatccagaacgag
aaggagaccatgcaaagcctgaacgaccgcctggcctcttacctggacagagtgaggagc
ctggagaccgagaaccggaggctggagagcaaaatccgggagcacttggagaagaaggga
ccccaggtcagagactggagccattacttcaagatcatcgaggacctgagggctcagatc
ttcgcaaatactgtggacaatgcccgcatcgttctgcagattgacaatgcccgtcttgct
gctgatgactttagagtcaagtatgagacagagctggccatgcgccagtctgtggagaac
gacatccatgggctccgcaaggtcattgatgacaccaatatcacacgactgcagctggag
acagagatcgaggctctcaaggaggagctgctcttcatgaagaagaaccacgaagaggaa
gtaaaaggcctacaagcccagattgccagctctgggttgaccgtggaggtagatgccccc
aaatctcaggacctcgccaagatcatggcagacatccgggcccaatatgacgagctggct
cggaagaaccgagaggagctagacaagtactggtctcagcagattgaggagagcaccaca
gtggtcaccacacagtctgctgaggttggagctgctgagacgacgctcacagagctgaga
cgtacagtccagtccttggagatcgacctggactccatgagaaatctgaaggccagcttg
gagaacagcctgagggaggtggaggcccgctacgccctacagatggagcagctcaacggg
atcctgctgcaccttgagtcagagctggcacagacccgggcagagggacagcgccaggcc
caggagtatgaggccctgctgaacatcaaggtcaagctggaggctgagatcgccacctac
cgccgcctgctggaagatggcgaggactttaatcttggtgatgccttggacagcagcaac
tccatgcaaaccatccaaaagaccaccacccgccggatagtggatggcaaagtggtgtct
gagaccaatgacaccaaagttctgaggcattaa

DBGET integrated database retrieval system