KEGG   Homo sapiens (human): 3875Help
Entry
3875              CDS       T01001                                 

Gene name
KRT18, CYK18, K18
Definition
keratin 18
Orthology
K07604  
type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    3875 (KRT18)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3875 (KRT18)
  Exosomal proteins of other body fluids (saliva and urine)
   3875 (KRT18)
  Exosomal proteins of colorectal cancer cells
   3875 (KRT18)
  Exosomal proteins of melanoma cells
   3875 (KRT18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12q13
AA seq 430 aa AA seqDB search
MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGS
GGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKG
PQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVEN
DIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAP
KSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELR
RTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQA
QEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVS
ETNDTKVLRH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaccactcgctccaccttctccaccaactaccggtccctgggctctgtccag
gcgcccagctacggcgcccggccggtcagcagcgcggccagcgtctatgcaggcgctggg
ggctctggttcccggatctccgtgtcccgctccaccagcttcaggggcggcatggggtcc
gggggcctggccaccgggatagccgggggtctggcaggaatgggaggcatccagaacgag
aaggagaccatgcaaagcctgaacgaccgcctggcctcttacctggacagagtgaggagc
ctggagaccgagaaccggaggctggagagcaaaatccgggagcacttggagaagaaggga
ccccaggtcagagactggagccattacttcaagatcatcgaggacctgagggctcagatc
ttcgcaaatactgtggacaatgcccgcatcgttctgcagattgacaatgcccgtcttgct
gctgatgactttagagtcaagtatgagacagagctggccatgcgccagtctgtggagaac
gacatccatgggctccgcaaggtcattgatgacaccaatatcacacgactgcagctggag
acagagatcgaggctctcaaggaggagctgctcttcatgaagaagaaccacgaagaggaa
gtaaaaggcctacaagcccagattgccagctctgggttgaccgtggaggtagatgccccc
aaatctcaggacctcgccaagatcatggcagacatccgggcccaatatgacgagctggct
cggaagaaccgagaggagctagacaagtactggtctcagcagattgaggagagcaccaca
gtggtcaccacacagtctgctgaggttggagctgctgagacgacgctcacagagctgaga
cgtacagtccagtccttggagatcgacctggactccatgagaaatctgaaggccagcttg
gagaacagcctgagggaggtggaggcccgctacgccctacagatggagcagctcaacggg
atcctgctgcaccttgagtcagagctggcacagacccgggcagagggacagcgccaggcc
caggagtatgaggccctgctgaacatcaaggtcaagctggaggctgagatcgccacctac
cgccgcctgctggaagatggcgaggactttaatcttggtgatgccttggacagcagcaac
tccatgcaaaccatccaaaagaccaccacccgccggatagtggatggcaaagtggtgtct
gagaccaatgacaccaaagttctgaggcattaa

DBGET integrated database retrieval system