KEGG   Homo sapiens (human): 3909Help
Entry
3909              CDS       T01001                                 

Gene name
LAMA3, BM600, E170, LAMNA, LOCS, lama3a
Definition
laminin, alpha 3
Orthology
K06240  
laminin, alpha 3/5
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Disease
H00585  
Epidermolysis bullosa, hemidesmosomal
H00586  
Epidermolysis bullosa, junctional
H00813  
Laryngo onycho cutaneous syndrome
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
18q11.2
AA seq 1724 aa AA seqDB search
MPPAVRRSACSMGWLWIFGAALGQCLGYSSQQQRVPFLQPPGQSQLQASYVEFRPSQGCS
PGYYRDHKGLYTGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHG
SCRACPCPHTNSFATGCVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSC
NSNGQLGSCHPLTGDCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQG
LSASAGLLEQMRHMETQAKDLRNQLLNYRSAISNHGSKIEGLERELTDLNQEFETLQEKA
QVNSRKAQTLNNNVNRATQSAKELDVKIKNVIRNVHILLKQISGTDGEGNNVPSGDFSRE
WAEAQRMMRELRNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLN
EYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADS
SLLQTNIALQLMEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHARSL
QELAKQLEEIKRNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIK
EDLPRKAKTLSSNSDKLLNEAKMTQKKLKQEVSPALNNLQQTLNIVTVQKEVIDTNLTTL
RDGLHGIQRGDIDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGRTQNEDFK
KALTDADNSVNKLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAV
PMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYI
GMAVVDGQLTCVYNLGDREAELQVDQILTKSETKEAVMDRVKFQRIYQFARLNYTKGATS
SKPETPGVYDMDGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLSFPPYKGCIELDDLNE
NVLSLYNFKKTFNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPHAPIPTFGQTIQTT
VDRGLLFFAENGDRFISLNIEDGKLMVRYKLNSELPKERGVGDAINNGRDHSIQIKIGKL
QKRMWINVDVQNTIIDGEVFDFSTYYLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVR
LNDTVGVTKKCSEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTFQPSGILLDH
QTWTRNLQVTLEDGYIELSTSDSGSPIFKSPQTYMDGLLHYVSVISDNSGLRLLIDDQLL
RNSKRLKHISSSRQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLGGCSL
NKPPFLMLLKGSTRFNKTKTFRINQLLQDTPVASPRSVKVWQDACSPLPKTQANHGALQF
GDIPTSHLLFKLPQELLKPRSQFAVDMQTTSSRGLVFHTGTKNSFMALYLSKGRLVFALG
TDGKKLRIKSKEKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRAPVYLG
SPPSGKPKSLPTNSFVGCLKNFQLDSKPLYTPSSSFGVSSCLGGPLEKGIYFSEEGGHVV
LAHSVLLGPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGGTSTS
VTPKQSLCDGQWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLT
TLRIPVWKSFFGCLRNIHVNHIPVPVTEALEVQGPVSLNGCPDQ
NT seq 5175 nt NT seq  +upstreamnt  +downstreamnt
atgcctccagcagtgaggcggtcagcctgcagcatgggatggctgtggatctttggggca
gccctggggcagtgtctgggctacagttcacagcagcaaagggtgccatttcttcagcct
cccggtcaaagtcaactgcaagcgagttatgtggagtttagacccagccagggttgtagc
cctggatactatcgggatcataaaggcttgtataccggacggtgtgttccctgcaattgc
aacggacattcaaatcaatgccaggatggctcaggcatatgtgttaactgtcagcacaac
accgcgggagagcactgtgaacgctgccaggagggctactatggcaacgccgtccacgga
tcctgcagggcctgcccatgtcctcacactaacagctttgccactggctgtgtggtgaat
gggggagacgtgcggtgctcctgcaaagctgggtacacaggaacacagtgtgaaaggtgt
gcaccgggatatttcgggaatccccagaaattcggaggtagctgccaaccatgcagttgt
aacagcaatggccagctgggcagctgtcatcccctgactggagactgcataaaccaagaa
cccaaagatagcagccctgcagaagaatgtgatgattgcgacagctgtgtgatgaccctc
ctgaacgacctggccaccatgggcgagcagctccgcctggtcaagtctcagctgcagggc
ctgagtgccagcgcagggcttctggagcagatgaggcacatggagacccaggccaaggac
ctgaggaatcagttgctcaactaccgttctgccatttcaaatcatggatcaaaaatagaa
ggcctggaaagagaactgactgatttgaatcaagaatttgagactttgcaagaaaaggct
caagtaaattccagaaaagcacaaacattaaacaacaatgttaatcgggcaacacaaagc
gcaaaagaactggatgtgaagattaaaaatgtcatccggaatgtgcacattcttttaaag
cagatctctgggacagatggagagggaaacaacgtgccttcaggtgacttttccagagag
tgggctgaagcccagcgcatgatgagggaactgcggaacaggaactttggaaagcacctc
agagaagcagaagctgataaaagggagtcgcagctcttgctgaaccggataaggacctgg
cagaaaacccaccagggggagaacaatgggcttgctaacagtatccgggattctttaaat
gaatacgaagccaaactcagtgaccttcgtgctcggctgcaggaggcagctgcccaagcc
aagcaggcaaatggcttgaaccaagaaaacgagagagctttgggagccattcagagacaa
gtgaaagaaataaattccctgcagagtgatttcaccaagtatctaaccactgcagactca
tctttgttgcaaaccaacattgcgctgcagctgatggagaaaagccagaaggaatatgaa
aaattagctgccagtttaaatgaagcaagacaagaactaagtgacaaagtaagagaactt
tccagatctgctggcaaaacatcccttgtggaggaggcagaaaagcacgcgcggtcctta
caagagctggcaaagcagctggaagagatcaagagaaacgccagcggggatgagctggtg
cgctgtgctgtggatgccgccaccgcctacgagaacatcctcaatgccatcaaagcggcc
gaggacgcagccaacagggctgccagtgcatctgaatctgccctccagacagtgataaag
gaagatctgccaagaaaagctaaaaccctgagttccaacagtgataaactgttaaatgaa
gccaagatgacacaaaagaagctaaagcaagaagtcagtccagctctcaacaacctacag
caaaccctgaatattgtgacagttcagaaagaagtgatagacaccaatctcacaactctc
cgagatggtcttcatgggatacagagaggtgatattgatgctatgatcagtagtgcaaag
agcatggtcagaaaggccaacgacatcacagatgaggttctggatgggctcaaccccatc
cagacagatgtggaaagaattaaggacacctatgggaggacacagaacgaagacttcaaa
aaggctctgactgatgcagataactcggtgaataagttaaccaacaaactacctgatctt
tggcgcaagattgaaagtatcaaccaacagctgttgcccttgggaaacatctctgacaac
atggacagaatacgagaactaattcagcaggccagagatgctgccagtaaggttgctgtc
cccatgaggttcaatggtaaatctggagtcgaagtccgactgccaaatgacctggaagat
ttgaaaggatatacatctctgtccttgtttctccaaaggcccaactcaagagaaaatggg
ggtactgagaatatgtttgtgatgtaccttggaaataaagatgcctcccgggactacatc
ggcatggcagttgtggatggccagctcacctgtgtctacaacctgggggaccgtgaggct
gaactccaagtggaccagatcttgaccaagagtgagactaaggaggcagttatggatcgg
gtgaaatttcagagaatttatcagtttgcaaggcttaattacaccaaaggagccacatcc
agtaaaccagaaacacccggagtctatgacatggatggtagaaatagcaatacactcctt
aatttggatcctgaaaatgttgtattttatgttggaggttacccacctgattttaaactt
cccagtcgactaagtttccctccatacaaaggttgtattgaattagatgacctcaatgaa
aatgttctgagcttgtacaacttcaaaaaaacattcaatctcaacacaactgaagtggag
ccttgtagaaggaggaaggaagagtcagacaaaaattattttgaaggtacgggctatgct
cgagttccaactcaaccacatgctcccatcccaacctttggacagacaattcagaccacc
gtggatagaggcttgctgttctttgcagaaaacggggatcgcttcatatctctaaatata
gaagatggcaagctcatggtgagatacaaactgaattcagagctaccaaaagagagagga
gttggagacgccataaacaacggcagagaccattcgattcagatcaaaattggaaaactc
caaaagcgtatgtggataaatgtggacgttcaaaacactataattgatggtgaagtattt
gatttcagcacatattatctgggaggaattccaattgcaatcagggaaagatttaacatt
tctacgcctgctttccgaggctgcatgaaaaatttgaagaaaaccagtggtgtcgttaga
ttgaatgatactgtgggagtaaccaaaaagtgctcggaagactggaagcttgtgcgatct
gcctcattctccagaggaggacaattgagtttcactgatttgggcttaccacctactgac
cacctccaggcctcatttggatttcagacctttcaacccagtggcatattattagatcat
cagacatggacaaggaacctgcaggtcactctggaagatggttacattgaattgagcacc
agcgatagcggcagcccaatttttaaatctccacagacgtatatggatggtttactgcat
tatgtatctgtaataagcgacaactctggactacggcttctcatcgatgaccagcttctg
agaaatagcaaaaggctaaaacacatttcaagttcccggcagtctctgcgtctgggcggg
agcaattttgagggttgtattagcaatgtttttgtccagaggttatcactgagtcctgaa
gtcctagatttgaccagtaactctctcaagagagatgtgtccctgggaggctgcagttta
aacaaaccaccttttctaatgttgcttaaaggttctaccaggtttaacaagaccaagact
tttcgtatcaaccagctgttgcaggacacaccagtggcctccccaaggagcgtgaaggtg
tggcaagatgcttgctcaccacttcccaagacccaggccaatcatggagccctccagttt
ggggacattcccaccagccacttgctattcaagcttcctcaggagctgctgaaacccagg
tcacagtttgctgtggacatgcagacaacatcctccagaggactggtgtttcacacgggc
actaagaactcctttatggctctttatctttcaaaaggacgtctggtctttgcactgggg
acagatgggaaaaaattgaggatcaaaagcaaggagaaatgcaatgatgggaaatggcac
acggtggtgtttggccatgatggggaaaaggggcgcttggttgtggatggactgagggcc
cgggagggaagtttgcctggaaactccaccatcagcatcagagcgccagtttacctggga
tcacctccatcagggaaaccaaagagcctccccacaaacagctttgtgggatgcctgaag
aactttcagctggattcaaaacccttgtataccccttcttcaagcttcggggtgtcttcc
tgcttgggtggtcctttggagaaaggcatttatttctctgaagaaggaggtcatgtcgtc
ttggctcactctgtattgttggggccagaatttaagcttgttttcagcatccgcccaaga
agtctcactgggatcctaatacacatcggaagtcagcccgggaagcacttatgtgtttac
ctggaggcaggaaaggtcacggcctctatggacagtggggcaggtgggacctcaacgtcg
gtcacaccaaagcagtctctgtgtgatggacagtggcactcggtggcagtcaccataaaa
caacacatcctgcacctggaactggacacagacagtagctacacagctggacagatcccc
ttcccacctgccagcactcaagagccactacaccttggaggtgctccagccaatttgacg
acactgaggatccctgtgtggaaatcattctttggctgtctgaggaatattcatgtcaat
cacatccctgtccctgtcactgaagccttggaagtccaggggcctgtcagtctgaatggt
tgtcctgaccagtaa

DBGET integrated database retrieval system