KEGG   Homo sapiens (human): 3916Help
Entry
3916              CDS       T01001                                 

Gene name
LAMP1, CD107a, LAMPA, LGP120
Definition
lysosomal-associated membrane protein 1
Orthology
K06528  
lysosomal-associated membrane protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3916 (LAMP1)
   04142 Lysosome
    3916 (LAMP1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    3916 (LAMP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   3916 (LAMP1)
Cellular antigens [BR:hsa04090]
 Proteins
  3916 (LAMP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
13q34
AA seq 417 aa AA seqDB search
MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGP
KNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVY
NLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLS
NSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQL
NLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF
LQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQ
AFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccccggcagcgcccggcgacccctgctgctgctactgctgttgctgctgctc
ggcctcatgcattgtgcgtcagcagcaatgtttatggtgaaaaatggcaacgggaccgcg
tgcataatggccaacttctctgctgccttctcagtgaactacgacaccaagagtggccct
aagaacatgacctttgacctgccatcagatgccacagtggtgctcaaccgcagctcctgt
ggaaaagagaacacttctgaccccagtctcgtgattgcttttggaagaggacatacactc
actctcaatttcacgagaaatgcaacacgttacagcgtccagctcatgagttttgtttat
aacttgtcagacacacaccttttccccaatgcgagctccaaagaaatcaagactgtggaa
tctataactgacatcagggcagatatagataaaaaatacagatgtgttagtggcacccag
gtccacatgaacaacgtgaccgtaacgctccatgatgccaccatccaggcgtacctttcc
aacagcagcttcagcaggggagagacacgctgtgaacaagacaggccttccccaaccaca
gcgccccctgcgccacccagcccctcgccctcacccgtgcccaagagcccctctgtggac
aagtacaacgtgagcggcaccaacgggacctgcctgctggccagcatggggctgcagctg
aacctcacctatgagaggaaggacaacacgacggtgacaaggcttctcaacatcaacccc
aacaagacctcggccagcgggagctgcggcgcccacctggtgactctggagctgcacagc
gagggcaccaccgtcctgctcttccagttcgggatgaatgcaagttctagccggtttttc
ctacaaggaatccagttgaatacaattcttcctgacgccagagaccctgcctttaaagct
gccaacggctccctgcgagcgctgcaggccacagtcggcaattcctacaagtgcaacgcg
gaggagcacgtccgtgtcacgaaggcgttttcagtcaatatattcaaagtgtgggtccag
gctttcaaggtggaaggtggccagtttggctctgtggaggagtgtctgctggacgagaac
agcatgctgatccccatcgctgtgggtggtgccctggcggggctggtcctcatcgtcctc
atcgcctacctcgtcggcaggaagaggagtcacgcaggctaccagactatctag

DBGET integrated database retrieval system