KEGG   Homo sapiens (human): 3916Help
Entry
3916              CDS       T01001                                 

Gene name
LAMP1, CD107a, LAMPA, LGP120
Definition
lysosomal-associated membrane protein 1
Orthology
K06528  
lysosomal-associated membrane protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Phagosome
Tuberculosis
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
13q34
AA seq 417 aa AA seqDB search
MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGP
KNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVY
NLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLS
NSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQL
NLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF
LQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQ
AFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccccggcagcgcccggcgacccctgctgctgctactgctgttgctgctgctc
ggcctcatgcattgtgcgtcagcagcaatgtttatggtgaaaaatggcaacgggaccgcg
tgcataatggccaacttctctgctgccttctcagtgaactacgacaccaagagtggccct
aagaacatgacctttgacctgccatcagatgccacagtggtgctcaaccgcagctcctgt
ggaaaagagaacacttctgaccccagtctcgtgattgcttttggaagaggacatacactc
actctcaatttcacgagaaatgcaacacgttacagcgtccagctcatgagttttgtttat
aacttgtcagacacacaccttttccccaatgcgagctccaaagaaatcaagactgtggaa
tctataactgacatcagggcagatatagataaaaaatacagatgtgttagtggcacccag
gtccacatgaacaacgtgaccgtaacgctccatgatgccaccatccaggcgtacctttcc
aacagcagcttcagcaggggagagacacgctgtgaacaagacaggccttccccaaccaca
gcgccccctgcgccacccagcccctcgccctcacccgtgcccaagagcccctctgtggac
aagtacaacgtgagcggcaccaacgggacctgcctgctggccagcatggggctgcagctg
aacctcacctatgagaggaaggacaacacgacggtgacaaggcttctcaacatcaacccc
aacaagacctcggccagcgggagctgcggcgcccacctggtgactctggagctgcacagc
gagggcaccaccgtcctgctcttccagttcgggatgaatgcaagttctagccggtttttc
ctacaaggaatccagttgaatacaattcttcctgacgccagagaccctgcctttaaagct
gccaacggctccctgcgagcgctgcaggccacagtcggcaattcctacaagtgcaacgcg
gaggagcacgtccgtgtcacgaaggcgttttcagtcaatatattcaaagtgtgggtccag
gctttcaaggtggaaggtggccagtttggctctgtggaggagtgtctgctggacgagaac
agcatgctgatccccatcgctgtgggtggtgccctggcggggctggtcctcatcgtcctc
atcgcctacctcgtcggcaggaagaggagtcacgcaggctaccagactatctag

DBGET integrated database retrieval system