KEGG   Homo sapiens (human): 392255Help
Entry
392255            CDS       T01001                                 

Gene name
GDF6, BMP-13, BMP13, CDMP2, KFM, KFS, KFS1, KFSL, LCA17, MCOP4, MCOPCB6, SCDO4, SGM1
Definition
growth differentiation factor 6
Orthology
K04664  
growth differentiation factor 5/6/7
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Hippo signaling pathway
Module
BMP signaling
Disease
H00852  
Klippel-Feil syndrome(KFS)
H01027  
Anophthalmia and microphthalmia (A/M)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    392255 (GDF6)
   04390 Hippo signaling pathway
    392255 (GDF6)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    392255 (GDF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
8q22.1
AA seq 455 aa AA seqDB search
MDTPRVLLSAVFLISFLWDLPGFQQASISSSSSSAELGSTKGMRSRKEGKMQRAPRDSDA
GREGQEPQPRPQDEPRAQQPRAQEPPGRGPRVVPHEYMLSIYRTYSIAEKLGINASFFQS
SKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPP
AGPLHVQLFPCLSPLLLDARTLDPQGAPPAGWEVFDVWQGLRHQPWKQLCLELRAAWGEL
DAGEAEARARGPQQPPPPDLRSLGFGRRVRPPQERALLVVFTRSQRKNLFAEMREQLGSA
EAAGPGAGAEGSWPPPSGAPDARPWLPSPGRRRRRTAFASRHGKRHGKKSRLRCSKKPLH
VNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCC
VPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggatactcccagggtcctgctctcggccgtcttcctcatcagttttctgtgggatttg
cccggtttccagcaggcttccatctcatcctcctcgtcgtccgccgagctgggttccacc
aagggcatgcgaagccgcaaggaaggcaagatgcagcgggcgccgcgcgacagtgacgcg
ggccgggagggccaggaaccacagccgcggcctcaggacgaaccccgggctcagcagccc
cgggcgcaggagccgccaggcaggggtccgcgcgtggtgccccacgagtacatgctgtca
atctacaggacttactccatcgctgagaagctgggcatcaatgccagctttttccagtct
tccaagtcggctaatacgatcaccagctttgtagacaggggactagacgatctctcgcac
actcctctccggagacagaagtatttgtttgatgtgtccatgctctcagacaaagaagag
ctggtgggcgcggagctgcggctctttcgccaggcgccctcagcgccctgggggccacca
gccgggccgctccacgtgcagctcttcccttgcctttcgcccctactgctggacgcgcgg
accctggacccgcagggggcgccgccggccggctgggaagtcttcgacgtgtggcagggc
ctgcgccaccagccctggaagcagctgtgcttggagctgcgggccgcatggggcgagctg
gacgccggggaggccgaggcgcgcgcgcggggaccccagcaaccgccgcccccggacctg
cggagtctgggcttcggccggagggtgcggcctccccaggagcgggccctgctggtggta
ttcaccagatcccagcgcaagaacctgttcgcagagatgcgcgagcagctgggctcggcc
gaggctgcgggcccgggcgcgggcgccgaggggtcgtggccgccgccgtcgggcgccccg
gatgccaggccttggctgccctcgcccggccgccggcggcggcgcacggccttcgccagt
cgccatggcaagcggcacggcaagaagtccaggctacgctgcagcaagaagcccctgcac
gtgaacttcaaggagctgggctgggacgactggattatcgcgcccctggagtacgaggcc
tatcactgcgagggtgtatgcgacttcccgctgcgctcgcacctggagcccaccaaccac
gccatcatccagacgctgatgaactccatggaccccggctccaccccgcccagctgctgc
gtgcccaccaaattgactcccatcagcattctatacatcgacgcgggcaataatgtggtc
tacaagcagtacgaggacatggtggtggagtcgtgcggctgcaggtag

DBGET integrated database retrieval system