KEGG   Homo sapiens (human): 3939Help
Entry
3939              CDS       T01001                                 

Gene name
LDHA, GSD11, HEL-S-133P, LDH1, LDHM
Definition
lactate dehydrogenase A (EC:1.1.1.27)
Orthology
K00016  
L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Cysteine and methionine metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
HIF-1 signaling pathway
Disease
H00069  
Glycogen storage diseases (GSD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    3939 (LDHA)
   00620 Pyruvate metabolism
    3939 (LDHA)
   00640 Propanoate metabolism
    3939 (LDHA)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    3939 (LDHA)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    3939 (LDHA)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     3939 (LDHA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3939 (LDHA)
  Exosomal proteins of breast milk
   3939 (LDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11p15.4
AA seq 274 aa AA seqDB search
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLRTPKIVSGKVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERL
GVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESA
YEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQN
GISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcaactctaaaggatcagctgatttataatcttctaaaggaagaacagaccccccag
aataagattacagttgttggggttggtgctgttggcatggcctgtgccatcagtatctta
atgaaggacttggcagatgaacttgctcttgttgatgtcatcgaagacaaattgaaggga
gagatgatggatctccaacatggcagccttttccttagaacaccaaagattgtctctggc
aaagtggatatcttgacctacgtggcttggaagataagtggttttcccaaaaaccgtgtt
attggaagcggttgcaatctggattcagcccgattccgttacctaatgggggaaaggctg
ggagttcacccattaagctgtcatgggtgggtccttggggaacatggagattccagtgtg
cctgtatggagtggaatgaatgttgctggtgtctctctgaagactctgcacccagattta
gggactgataaagataaggaacagtggaaagaggttcacaagcaggtggttgagagtgct
tatgaggtgatcaaactcaaaggctacacatcctgggctattggactctctgtagcagat
ttggcagagagtataatgaagaatcttaggcgggtgcacccagtttccaccatgattaag
ggtctttacggaataaaggatgatgtcttccttagtgttccttgcattttgggacagaat
ggaatctcagaccttgtgaaggtgactctgacttctgaggaagaggcccgtttgaagaag
agtgcagatacactttgggggatccaaaaggagctgcaattttaa

DBGET integrated database retrieval system