KEGG   Homo sapiens (human): 3945Help
Entry
3945              CDS       T01001                                 

Gene name
LDHB, HEL-S-281, LDH-B, LDH-H, LDHBD, TRG-5
Definition
(RefSeq) lactate dehydrogenase B (EC:1.1.1.27)
  KO
K00016  
L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Cysteine and methionine metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of antibiotics
Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    3945 (LDHB)
   00620 Pyruvate metabolism
    3945 (LDHB)
   00640 Propanoate metabolism
    3945 (LDHB)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    3945 (LDHB)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    3945 (LDHB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     3945 (LDHB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3945 (LDHB)
  Exosomal proteins of breast milk
   3945 (LDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
12p12.2-p12.1
AA seq 334 aa AA seqDB search
MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLK
GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY
EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcttaaggaaaaactcattgcaccagttgcggaagaagaggcaacagttcca
aacaataagatcactgtagtgggtgttggacaagttggtatggcgtgtgctatcagcatt
ctgggaaagtctctggctgatgaacttgctcttgtggatgttttggaagataagcttaaa
ggagaaatgatggatctgcagcatgggagcttatttcttcagacacctaaaattgtggca
gataaagattattctgtgaccgccaattctaagattgtagtggtaactgcaggagtccgt
cagcaagaaggggagagtcggctcaatctggtgcagagaaatgttaatgtcttcaaattc
attattcctcagatcgtcaagtacagtcctgattgcatcataattgtggtttccaaccca
gtggacattcttacgtatgttacctggaaactaagtggattacccaaacaccgcgtgatt
ggaagtggatgtaatctggattctgctagatttcgctaccttatggctgaaaaacttggc
attcatcccagcagctgccatggatggattttgggggaacatggcgactcaagtgtggct
gtgtggagtggtgtgaatgtggcaggtgtttctctccaggaattgaatccagaaatggga
actgacaatgatagtgaaaattggaaggaagtgcataagatggtggttgaaagtgcctat
gaagtcatcaagctaaaaggatataccaactgggctattggattaagtgtggctgatctt
attgaatccatgttgaaaaatctatccaggattcatcccgtgtcaacaatggtaaagggg
atgtatggcattgagaatgaagtcttcctgagccttccatgtatcctcaatgcccgggga
ttaaccagcgttatcaaccagaagctaaaggatgatgaggttgctcagctcaagaaaagt
gcagataccctgtgggacatccagaaggacctaaaagacctgtga

DBGET integrated database retrieval system