KEGG   Homo sapiens (human): 3945Help
Entry
3945              CDS       T01001                                 

Gene name
LDHB, HEL-S-281, LDH-B, LDH-H, LDHBD, TRG-5
Definition
lactate dehydrogenase B (EC:1.1.1.27)
Orthology
K00016  
L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Cysteine and methionine metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hsa00640]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hsa00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
12p12.2-p12.1
AA seq 334 aa AA seqDB search
MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLK
GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY
EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcttaaggaaaaactcattgcaccagttgcggaagaagaggcaacagttcca
aacaataagatcactgtagtgggtgttggacaagttggtatggcgtgtgctatcagcatt
ctgggaaagtctctggctgatgaacttgctcttgtggatgttttggaagataagcttaaa
ggagaaatgatggatctgcagcatgggagcttatttcttcagacacctaaaattgtggca
gataaagattattctgtgaccgccaattctaagattgtagtggtaactgcaggagtccgt
cagcaagaaggggagagtcggctcaatctggtgcagagaaatgttaatgtcttcaaattc
attattcctcagatcgtcaagtacagtcctgattgcatcataattgtggtttccaaccca
gtggacattcttacgtatgttacctggaaactaagtggattacccaaacaccgcgtgatt
ggaagtggatgtaatctggattctgctagatttcgctaccttatggctgaaaaacttggc
attcatcccagcagctgccatggatggattttgggggaacatggcgactcaagtgtggct
gtgtggagtggtgtgaatgtggcaggtgtttctctccaggaattgaatccagaaatggga
actgacaatgatagtgaaaattggaaggaagtgcataagatggtggttgaaagtgcctat
gaagtcatcaagctaaaaggatataccaactgggctattggattaagtgtggctgatctt
attgaatccatgttgaaaaatctatccaggattcatcccgtgtcaacaatggtaaagggg
atgtatggcattgagaatgaagtcttcctgagccttccatgtatcctcaatgcccgggga
ttaaccagcgttatcaaccagaagctaaaggatgatgaggttgctcagctcaagaaaagt
gcagataccctgtgggacatccagaaggacctaaaagacctgtga

DBGET integrated database retrieval system