KEGG   Homo sapiens (human): 3945Help
Entry
3945              CDS       T01001                                 

Gene name
LDHB, HEL-S-281, LDH-B, LDH-H, LDHBD, TRG-5
Definition
(RefSeq) lactate dehydrogenase B
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00270  Cysteine and methionine metabolism
hsa00620  Pyruvate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    3945 (LDHB)
   00620 Pyruvate metabolism
    3945 (LDHB)
   00640 Propanoate metabolism
    3945 (LDHB)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    3945 (LDHB)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    3945 (LDHB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     3945 (LDHB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3945 (LDHB)
  Exosomal proteins of breast milk
   3945 (LDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4
Motif
Other DBs
NCBI-GeneID: 3945
NCBI-ProteinID: NP_001167568
OMIM: 150100
HGNC: 6541
Ensembl: ENSG00000111716
Vega: OTTHUMG00000133760
Pharos: P07195(Tchem)
UniProt: P07195 Q5U077
LinkDB All DBs
Structure
PDB: 

Jmol
Position
12p12.1
AA seq 334 aa AA seqDB search
MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLK
GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY
EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcttaaggaaaaactcattgcaccagttgcggaagaagaggcaacagttcca
aacaataagatcactgtagtgggtgttggacaagttggtatggcgtgtgctatcagcatt
ctgggaaagtctctggctgatgaacttgctcttgtggatgttttggaagataagcttaaa
ggagaaatgatggatctgcagcatgggagcttatttcttcagacacctaaaattgtggca
gataaagattattctgtgaccgccaattctaagattgtagtggtaactgcaggagtccgt
cagcaagaaggggagagtcggctcaatctggtgcagagaaatgttaatgtcttcaaattc
attattcctcagatcgtcaagtacagtcctgattgcatcataattgtggtttccaaccca
gtggacattcttacgtatgttacctggaaactaagtggattacccaaacaccgcgtgatt
ggaagtggatgtaatctggattctgctagatttcgctaccttatggctgaaaaacttggc
attcatcccagcagctgccatggatggattttgggggaacatggcgactcaagtgtggct
gtgtggagtggtgtgaatgtggcaggtgtttctctccaggaattgaatccagaaatggga
actgacaatgatagtgaaaattggaaggaagtgcataagatggtggttgaaagtgcctat
gaagtcatcaagctaaaaggatataccaactgggctattggattaagtgtggctgatctt
attgaatccatgttgaaaaatctatccaggattcatcccgtgtcaacaatggtaaagggg
atgtatggcattgagaatgaagtcttcctgagccttccatgtatcctcaatgcccgggga
ttaaccagcgttatcaaccagaagctaaaggatgatgaggttgctcagctcaagaaaagt
gcagataccctgtgggacatccagaaggacctaaaagacctgtga

DBGET integrated database retrieval system