KEGG   Homo sapiens (human): 4023Help
Entry
4023              CDS       T01001                                 

Gene name
LPL, HDLCQ11, LIPD
Definition
lipoprotein lipase (EC:3.1.1.34)
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Disease
H00154  
Hyperlipoproteinemia, type I
Drug target
Other: 
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
8p22
AA seq 475 aa AA seqDB search
MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEH
YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcgtgctgactctggccgtgtggctccagagtctgaccgcc
tcccgcggaggggtggccgccgccgaccaaagaagagattttatcgacatcgaaagtaaa
tttgccctaaggacccctgaagacacagctgaggacacttgccacctcattcccggagta
gcagagtccgtggctacctgtcatttcaatcacagcagcaaaaccttcatggtgatccat
ggctggacggtaacaggaatgtatgagagttgggtgccaaaacttgtggccgccctgtac
aagagagaaccagactccaatgtcattgtggtggactggctgtcacgggctcaggagcat
tacccagtgtccgcgggctacaccaaactggtgggacaggatgtggcccggtttatcaac
tggatggaggaggagtttaactaccctctggacaatgtccatctcttgggatacagcctt
ggagcccatgctgctggcattgcaggaagtctgaccaataagaaagtcaacagaattact
ggcctcgatccagctggacctaactttgagtatgcagaagccccgagtcgtctttctcct
gatgatgcagattttgtagacgtcttacacacattcaccagagggtcccctggtcgaagc
attggaatccagaaaccagttgggcatgttgacatttacccgaatggaggtacttttcag
ccaggatgtaacattggagaagctatccgcgtgattgcagagagaggacttggagatgtg
gaccagctagtgaagtgctcccacgagcgctccattcatctcttcatcgactctctgttg
aatgaagaaaatccaagtaaggcctacaggtgcagttccaaggaagcctttgagaaaggg
ctctgcttgagttgtagaaagaaccgctgcaacaatctgggctatgagatcaataaagtc
agagccaaaagaagcagcaaaatgtacctgaagactcgttctcagatgccctacaaagtc
ttccattaccaagtaaagattcatttttctgggactgagagtgaaacccataccaatcag
gcctttgagatttctctgtatggcaccgtggccgagagtgagaacatcccattcactctg
cctgaagtttccacaaataagacctactccttcctaatttacacagaggtagatattgga
gaactactcatgttgaagctcaaatggaagagtgattcatactttagctggtcagactgg
tggagcagtcccggcttcgccattcagaagatcagagtaaaagcaggagagactcagaaa
aaggtgatcttctgttctagggagaaagtgtctcatttgcagaaaggaaaggcacctgcg
gtatttgtgaaatgccatgacaagtctctgaataagaagtcaggctga

DBGET integrated database retrieval system