KEGG   Homo sapiens (human): 4041Help
Entry
4041              CDS       T01001                                 

Gene name
LRP5, BMND1, EVR1, EVR4, HBM, LR3, LRP-5, LRP7, OPPG, OPS, OPTA1, PCLD4, VBCH2
Definition
(RefSeq) LDL receptor related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05200  Pathways in cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
Disease
H00436  Osteopetrosis
H00450  Sclerosing bone dysplasias
H00451  Osteoporosis-pseudoglioma syndrome (OPPG)
H00589  Familial exudative vitreoretinopathy (FEVR)
H01593  Osteoporosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    4041 (LRP5)
   04150 mTOR signaling pathway
    4041 (LRP5)
 Organismal Systems
  Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    4041 (LRP5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4041 (LRP5)
   05225 Hepatocellular carcinoma
    4041 (LRP5)
   05226 Gastric cancer
    4041 (LRP5)
   05224 Breast cancer
    4041 (LRP5)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    4041 (LRP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL
Motif
Other DBs
NCBI-GeneID: 4041
NCBI-ProteinID: NP_002326
OMIM: 603506
HGNC: 6697
Ensembl: ENSG00000162337
Vega: OTTHUMG00000167570
Pharos: O75197(Tbio)
UniProt: O75197
LinkDB All DBs
Position
11q13.2
AA seq 1615 aa AA seqDB search
MEAAPPGPPWPLLLLLLLLLALCGCPAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVS
GLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGK
KLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAG
MDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHP
FALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCE
EDNGGCSHLCLLSPSEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTP
DFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDG
IAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGE
NPKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTL
LEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVV
GTNPCADRNGGCSHLCFFTPHATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISL
ETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYP
EGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEW
GGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVV
IADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQ
DGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKSAISRMI
PDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQ
NPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGY
LYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCD
LSGANRLTLEDANIVQPLGLTILGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVAHLTG
IHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCS
PDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGE
ADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDS
PAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAP
GGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNP
PPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKAS
KYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
NT seq 4848 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagcgccgcccgggccgccgtggccgctgctgctgctgctgctgctgctgctg
gcgctgtgcggctgcccggcccccgccgcggcctcgccgctcctgctatttgccaaccgc
cgggacgtacggctggtggacgccggcggagtcaagctggagtccaccatcgtggtcagc
ggcctggaggatgcggccgcagtggacttccagttttccaagggagccgtgtactggaca
gacgtgagcgaggaggccatcaagcagacctacctgaaccagacgggggccgccgtgcag
aacgtggtcatctccggcctggtctctcccgacggcctcgcctgcgactgggtgggcaag
aagctgtactggacggactcagagaccaaccgcatcgaggtggccaacctcaatggcaca
tcccggaaggtgctcttctggcaggaccttgaccagccgagggccatcgccttggacccc
gctcacgggtacatgtactggacagactggggtgagacgccccggattgagcgggcaggg
atggatggcagcacccggaagatcattgtggactcggacatttactggcccaatggactg
accatcgacctggaggagcagaagctctactgggctgacgccaagctcagcttcatccac
cgtgccaacctggacggctcgttccggcagaaggtggtggagggcagcctgacgcacccc
ttcgccctgacgctctccggggacactctgtactggacagactggcagacccgctccatc
catgcctgcaacaagcgcactggggggaagaggaaggagatcctgagtgccctctactca
cccatggacatccaggtgctgagccaggagcggcagcctttcttccacactcgctgtgag
gaggacaatggcggctgctcccacctgtgcctgctgtccccaagcgagcctttctacaca
tgcgcctgccccacgggtgtgcagctgcaggacaacggcaggacgtgtaaggcaggagcc
gaggaggtgctgctgctggcccggcggacggacctacggaggatctcgctggacacgccg
gacttcaccgacatcgtgctgcaggtggacgacatccggcacgccattgccatcgactac
gacccgctagagggctatgtctactggacagatgacgaggtgcgggccatccgcagggcg
tacctggacgggtctggggcgcagacgctggtcaacaccgagatcaacgaccccgatggc
atcgcggtcgactgggtggcccgaaacctctactggaccgacacgggcacggaccgcatc
gaggtgacgcgcctcaacggcacctcccgcaagatcctggtgtcggaggacctggacgag
ccccgagccatcgcactgcaccccgtgatgggcctcatgtactggacagactggggagag
aaccctaaaatcgagtgtgccaacttggatgggcaggagcggcgtgtgctggtcaatgcc
tccctcgggtggcccaacggcctggccctggacctgcaggaggggaagctctactgggga
gacgccaagacagacaagatcgaggtgatcaatgttgatgggacgaagaggcggaccctc
ctggaggacaagctcccgcacatttttgggttcacgctgctgggggacttcatctactgg
actgactggcagcgccgcagcatcgagcgggtgcacaaggtcaaggccagccgggacgtc
atcattgaccagctgcccgacctgatggggctcaaagctgtgaatgtggccaaggtcgtc
ggaaccaacccgtgtgcggacaggaacggggggtgcagccacctgtgcttcttcacaccc
cacgcaacccggtgtggctgccccatcggcctggagctgctgagtgacatgaagacctgc
atcgtgcctgaggccttcttggtcttcaccagcagagccgccatccacaggatctccctc
gagaccaataacaacgacgtggccatcccgctcacgggcgtcaaggaggcctcagccctg
gactttgatgtgtccaacaaccacatctactggacagacgtcagcctgaagaccatcagc
cgcgccttcatgaacgggagctcggtggagcacgtggtggagtttggccttgactacccc
gagggcatggccgttgactggatgggcaagaacctctactgggccgacactgggaccaac
agaatcgaagtggcgcggctggacgggcagttccggcaagtcctcgtgtggagggacttg
gacaacccgaggtcgctggccctggatcccaccaagggctacatctactggaccgagtgg
ggcggcaagccgaggatcgtgcgggccttcatggacgggaccaactgcatgacgctggtg
gacaaggtgggccgggccaacgacctcaccattgactacgctgaccagcgcctctactgg
accgacctggacaccaacatgatcgagtcgtccaacatgctgggtcaggagcgggtcgtg
attgccgacgatctcccgcacccgttcggtctgacgcagtacagcgattatatctactgg
acagactggaatctgcacagcattgagcgggccgacaagactagcggccggaaccgcacc
ctcatccagggccacctggacttcgtgatggacatcctggtgttccactcctcccgccag
gatggcctcaatgactgtatgcacaacaacgggcagtgtgggcagctgtgccttgccatc
cccggcggccaccgctgcggctgcgcctcacactacaccctggaccccagcagccgcaac
tgcagcccgcccaccaccttcttgctgttcagccagaaatctgccatcagtcggatgatc
ccggacgaccagcacagcccggatctcatcctgcccctgcatggactgaggaacgtcaaa
gccatcgactatgacccactggacaagttcatctactgggtggatgggcgccagaacatc
aagcgagccaaggacgacgggacccagccctttgttttgacctctctgagccaaggccaa
aacccagacaggcagccccacgacctcagcatcgacatctacagccggacactgttctgg
acgtgcgaggccaccaataccatcaacgtccacaggctgagcggggaagccatgggggtg
gtgctgcgtggggaccgcgacaagcccagggccatcgtcgtcaacgcggagcgagggtac
ctgtacttcaccaacatgcaggaccgggcagccaagatcgaacgcgcagccctggacggc
accgagcgcgaggtcctcttcaccaccggcctcatccgccctgtggccctggtggtggac
aacacactgggcaagctgttctgggtggacgcggacctgaagcgcattgagagctgtgac
ctgtcaggggccaaccgcctgaccctggaggacgccaacatcgtgcagcctctgggcctg
accatccttggcaagcatctctactggatcgaccgccagcagcagatgatcgagcgtgtg
gagaagaccaccggggacaagcggactcgcatccagggccgtgtcgcccacctcactggc
atccatgcagtggaggaagtcagcctggaggagttctcagcccacccatgtgcccgtgac
aatggtggctgctcccacatctgtattgccaagggtgatgggacaccacggtgctcatgc
ccagtccacctcgtgctcctgcagaacctgctgacctgtggagagccgcccacctgctcc
ccggaccagtttgcatgtgccacaggggagatcgactgtatccccggggcctggcgctgt
gacggctttcccgagtgcgatgaccagagcgacgaggagggctgccccgtgtgctccgcc
gcccagttcccctgcgcgcggggtcagtgtgtggacctgcgcctgcgctgcgacggcgag
gcagactgtcaggaccgctcagacgaggcggactgtgacgccatctgcctgcccaaccag
ttccggtgtgcgagcggccagtgtgtcctcatcaaacagcagtgcgactccttccccgac
tgtatcgacggctccgacgagctcatgtgtgaaatcaccaagccgccctcagacgacagc
ccggcccacagcagtgccatcgggcccgtcattggcatcatcctctctctcttcgtcatg
ggtggtgtctattttgtgtgccagcgcgtggtgtgccagcgctatgcgggggccaacggg
cccttcccgcacgagtatgtcagcgggaccccgcacgtgcccctcaatttcatagccccg
ggcggttcccagcatggccccttcacaggcatcgcatgcggaaagtccatgatgagctcc
gtgagcctgatggggggccggggcggggtgcccctctacgaccggaaccacgtcacaggg
gcctcgtccagcagctcgtccagcacgaaggccacgctgtacccgccgatcctgaacccg
ccgccctccccggccacggacccctccctgtacaacatggacatgttctactcttcaaac
attccggccactgcgagaccgtacaggccctacatcattcgaggaatggcgcccccgacg
acgccctgcagcaccgacgtgtgtgacagcgactacagcgccagccgctggaaggccagc
aagtactacctggatttgaactcggactcagacccctatccacccccacccacgccccac
agccagtacctgtcggcggaggacagctgcccgccctcgcccgccaccgagaggagctac
ttccatctcttcccgccccctccgtccccctgcacggactcatcctga

DBGET integrated database retrieval system