KEGG   Homo sapiens (human): 404672Help
Entry
404672            CDS       T01001                                 

Gene name
GTF2H5, C6orf175, TFB5, TFIIH, TGF2H5, TTD, TTD-A, TTDA, bA120J8.2
Definition
general transcription factor IIH, polypeptide 5
Orthology
K10845  
TFIIH basal transcription factor complex TTD-A subunit
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Disease
H00403  
Disorders of nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:hsa03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hsa03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
6q25.3
AA seq 71 aa AA seqDB search
MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGEL
MDQNAFSLTQK
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacgtcttgaaaggagtgcttatagaatgtgatcctgccatgaagcagtttctg
ctgtacttggatgagtccaatgccctggggaagaagttcatcattcaagacattgatgac
actcacgtctttgtaatagcagaattggttaatgtcctccaggagcgagtgggtgaatta
atggaccaaaatgctttttcccttacccagaaatga

DBGET integrated database retrieval system