KEGG   Homo sapiens (human): 4055Help
Entry
4055              CDS       T01001                                 

Gene name
LTBR, CD18, D12S370, LT-BETA-R, TNF-R-III, TNFCR, TNFR-RP, TNFR2-RP, TNFR3, TNFRSF3
Definition
lymphotoxin beta receptor (TNFR superfamily, member 3)
Orthology
K03159  
lymphotoxin beta receptor TNFR superfamily member 3
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
HIF-1 signaling pathway
Intestinal immune network for IgA production
HTLV-I infection
Viral carcinogenesis
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    4055 (LTBR)
   04066 HIF-1 signaling pathway
    4055 (LTBR)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4055 (LTBR)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    4055 (LTBR)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    4055 (LTBR)
  Infectious diseases
   05166 HTLV-I infection
    4055 (LTBR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
12p13
AA seq 416 aa AA seqDB search
MEATGISLASQLKVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTV
CATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALEC
THCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEA
APGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLG
SLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVP
QQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLP
ATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgacaggaatctcattagcatctcaattaaaggtgcctccatatgcgtcggag
aaccagacctgcagggaccaggaaaaggaatactatgagccccagcaccgcatctgctgc
tcccgctgcccgccaggcacctatgtctcagctaaatgtagccgcatccgggacacagtt
tgtgccacatgtgccgagaattcctacaacgagcactggaactacctgaccatctgccag
ctgtgccgcccctgtgacccagtgatgggcctcgaggagattgccccctgcacaagcaaa
cggaagacccagtgccgctgccagccgggaatgttctgtgctgcctgggccctcgagtgt
acacactgcgagctactttctgactgcccgcctggcactgaagccgagctcaaagatgaa
gttgggaagggtaacaaccactgcgtcccctgcaaggccgggcacttccagaatacctcc
tcccccagcgcccgctgccagccccacaccaggtgtgagaaccaaggtctggtggaggca
gctccaggcactgcccagtccgacacaacctgcaaaaatccattagagccactgccccca
gagatgtcaggaaccatgctgatgctggccgttctgctgccactggccttctttctgctc
cttgccaccgtcttctcctgcatctggaagagccacccttctctctgcaggaaactggga
tcgctgctcaagaggcgtccgcagggagagggacccaatcctgtagctggaagctgggag
cctccgaaggcccatccatacttccctgacttggtacagccactgctacccatttctgga
gatgtttccccagtatccactgggctccccgcagccccagttttggaggcaggggtgccg
caacagcagagtcctctggacctgaccagggagccgcagttggaacccggggagcagagc
caggtggcccacggtaccaatggcattcatgtcaccggcgggtctatgactatcactggc
aacatctacatctacaatggaccagtactggggggaccaccgggtcctggagacctccca
gctacccccgaacctccataccccattcccgaagagggggaccctggccctcccgggctc
tctacaccccaccaggaagatggcaaggcttggcacctagcggagacagagcactgtggt
gccacaccctctaacaggggcccaaggaaccaatttatcacccatgactga

DBGET integrated database retrieval system