KEGG   Homo sapiens (human): 4088Help
Entry
4088              CDS       T01001                                 

Gene name
SMAD3, HSPC193, HsT17436, JV15-2, LDS1C, LDS3, MADH3
Definition
SMAD family member 3
Orthology
K04500  
mothers against decapentaplegic homolog 2/3
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
Endocytosis
Wnt signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
Hepatitis B
HTLV-I infection
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Inflammatory bowel disease (IBD)
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Colorectal cancer [PATH:hsa05210]
Human Diseases; Cancers; Pancreatic cancer [PATH:hsa05212]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
15q22.33
AA seq 320 aa AA seqDB search
MELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTN
FPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVT
YCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVEL
TRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNN
QEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQ
WLDKVLTQMGSPSIRCSSVS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtgtgagttcgccttcaatatgaagaaggacgaggtctgcgtgaatccctac
cactaccagagagtagagacaccagttctacctcctgtgttggtgccacgccacacagag
atcccggccgagttccccccactggacgactacagccattccatccccgaaaacactaac
ttccccgcaggcatcgagccccagagcaatattccagagaccccaccccctggctacctg
agtgaagatggagaaaccagtgaccaccagatgaaccacagcatggacgcaggttctcca
aacctatccccgaatccgatgtccccagcacataataacttggacctgcagccagttacc
tactgcgagccggccttctggtgctccatctcctactacgagctgaaccagcgcgtcggg
gagacattccacgcctcgcagccatccatgactgtggatggcttcaccgacccctccaat
tcggagcgcttctgcctagggctgctctccaatgtcaacaggaatgcagcagtggagctg
acacggagacacatcggaagaggcgtgcggctctactacatcggaggggaggtcttcgca
gagtgcctcagtgacagcgctatttttgtccagtctcccaactgtaaccagcgctatggc
tggcacccggccaccgtctgcaagatcccaccaggatgcaacctgaagatcttcaacaac
caggagttcgctgccctcctggcccagtcggtcaaccagggctttgaggctgtctaccag
ttgacccgaatgtgcaccatccgcatgagcttcgtcaaaggctggggagcggagtacagg
agacagactgtgaccagtaccccctgctggattgagctgcacctgaatgggcctttgcag
tggcttgacaaggtcctcacccagatgggctccccaagcatccgctgttccagtgtgtct
tag

DBGET integrated database retrieval system