KEGG   Homo sapiens (human): 4088Help
Entry
4088              CDS       T01001                                 

Gene name
SMAD3, HSPC193, HsT17436, JV15-2, LDS1C, LDS3, MADH3
Definition
(RefSeq) SMAD family member 3
  KO
K04500  
mothers against decapentaplegic homolog 2/3
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
Endocytosis
Wnt signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Adherens junction
Signaling pathways regulating pluripotency of stem cells
AGE-RAGE signaling pathway in diabetic complications
Chagas disease (American trypanosomiasis)
Hepatitis B
HTLV-I infection
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Inflammatory bowel disease (IBD)
Module
TGF-beta signaling
Activin signaling
Disease
H00800  
Loeys-Dietz syndrome (LDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    4088 (SMAD3)
   04350 TGF-beta signaling pathway
    4088 (SMAD3)
   04390 Hippo signaling pathway
    4088 (SMAD3)
   04068 FoxO signaling pathway
    4088 (SMAD3)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    4088 (SMAD3)
  Cell growth and death
   04110 Cell cycle
    4088 (SMAD3)
  Cellular commiunity
   04520 Adherens junction
    4088 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    4088 (SMAD3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4088 (SMAD3)
   05210 Colorectal cancer
    4088 (SMAD3)
   05212 Pancreatic cancer
    4088 (SMAD3)
   05220 Chronic myeloid leukemia
    4088 (SMAD3)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    4088 (SMAD3)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    4088 (SMAD3)
  Infectious diseases
   05166 HTLV-I infection
    4088 (SMAD3)
   05161 Hepatitis B
    4088 (SMAD3)
   05142 Chagas disease (American trypanosomiasis)
    4088 (SMAD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
15q22.33
AA seq 425 aa AA seqDB search
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcctgcctttcactcccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaaatggtgcgagaaggcggtcaagagcctggtcaag
aaactcaagaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggttgcaggtgtcccatcgg
aaggggctccctcatgtcatctactgccgcctgtggcgatggccagacctgcacagccac
cacgagctacgggccatggagctgtgtgagttcgccttcaatatgaagaaggacgaggtc
tgcgtgaatccctaccactaccagagagtagagacaccagttctacctcctgtgttggtg
ccacgccacacagagatcccggccgagttccccccactggacgactacagccattccatc
cccgaaaacactaacttccccgcaggcatcgagccccagagcaatattccagagacccca
ccccctggctacctgagtgaagatggagaaaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacataataacttggac
ctgcagccagttacctactgcgagccggccttctggtgctccatctcctactacgagctg
aaccagcgcgtcggggagacattccacgcctcgcagccatccatgactgtggatggcttc
accgacccctccaattcggagcgcttctgcctagggctgctctccaatgtcaacaggaat
gcagcagtggagctgacacggagacacatcggaagaggcgtgcggctctactacatcgga
ggggaggtcttcgcagagtgcctcagtgacagcgctatttttgtccagtctcccaactgt
aaccagcgctatggctggcacccggccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagttcgctgccctcctggcccagtcggtcaaccagggcttt
gaggctgtctaccagttgacccgaatgtgcaccatccgcatgagcttcgtcaaaggctgg
ggagcggagtacaggagacagactgtgaccagtaccccctgctggattgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system