KEGG   Homo sapiens (human): 4094Help
Entry
4094              CDS       T01001                                 

Gene name
MAF, CCA4, c-MAF
Definition
v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog
Orthology
K09035  
transcription factor Maf
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Inflammatory bowel disease (IBD)
Disease
H00010  
Multiple myeloma
H01202  
Cataract
Class
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
16q22-q23
AA seq 373 aa AA seqDB search
MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPM
STPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPEDAVEALISN
SHQLQGGFDGYARGAQQLAAAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGAGPH
YHHHHHHAAGHHHHPTAGAPGAAGSAAASAGGAGGAGGGGPASAGGGGGGGGGGGGGGAA
GAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRG
YAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENG
SSSDNPSSPEFFM
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagaactggcaatgagcaactccgacctgcccaccagtcccctggccatggaa
tatgttaatgacttcgatctgatgaagtttgaagtgaaaaaggaaccggtggagaccgac
cgcatcatcagccagtgcggccgtctcatcgccgggggctcgctgtcctccacccccatg
agcacgccgtgcagctcggtgcccccttcccccagcttctcggcgcccagcccgggctcg
ggcagcgagcagaaggcgcacctggaagactactactggatgaccggctacccgcagcag
ctgaaccccgaggcgctgggcttcagccccgaggacgcggtcgaggcgctcatcagcaac
agccaccagctccagggcggcttcgatggctacgcgcgcggggcgcagcagctggccgcg
gcggccggggccggtgccggcgcctccttgggcggcagcggcgaggagatgggccccgcc
gccgccgtggtgtccgccgtgatcgccgcggccgccgcgcagagcggcgcgggcccgcac
taccaccaccaccaccaccacgccgccggccaccaccaccacccgacggccggcgcgccc
ggcgccgcgggcagcgcggccgcctcggccggtggcgctgggggcgcgggcggcggtggc
ccggccagcgctgggggcggcggcggcggcggcggcggcggaggcggcgggggcgcggcg
ggggcggggggcgccctgcacccgcaccacgccgccggcggcctgcacttcgacgaccgc
ttctccgacgagcagctggtgaccatgtctgtgcgcgagctgaaccggcagctgcgcggg
gtcagcaaggaggaggtgatccggctgaagcagaagaggcggaccctgaaaaaccgcggc
tatgcccagtcctgccgcttcaagagggtgcagcagagacacgtcctggagtcggagaag
aaccagctgctgcagcaagtcgaccacctcaagcaggagatctccaggctggtgcgcgag
agggacgcgtacaaggagaaatacgagaagttggtgagcagcggcttccgagaaaacggc
tcgagcagcgacaacccgtcctctcccgagtttttcatgtga

DBGET integrated database retrieval system