KEGG   Homo sapiens (human): 410Help
Entry
410               CDS       T01001                                 

Gene name
ARSA, MLD
Definition
arylsulfatase A (EC:3.1.6.8)
Orthology
K01134  
arylsulfatase A [EC:3.1.6.8]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Lysosome
Disease
H00127  
Metachromatic leukodystrophy (MLD)
H00423  
Defects in the degradation of sulfatide
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:hsa00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
22q13.33
AA seq 509 aa AA seqDB search
MSMGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLR
FTDFYVPVSLCTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLT
GMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVP
IPLLANLSVEAQPPWLPGLEARYMAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSF
AERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLL
RCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDL
SPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASS
SLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVA
RGEDPALQICCHPGCTPRPACCHCPDPHA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgggggcaccgcggtccctcctcctggccctggctgctggcctggccgttgcc
cgtccgcccaacatcgtgctgatctttgccgacgacctcggctatggggacctgggctgc
tatgggcaccccagctctaccactcccaacctggaccagctggcggcgggagggctgcgg
ttcacagacttctacgtgcctgtgtctctgtgcacaccctctagggccgccctcctgacc
ggccggctcccggttcggatgggcatgtaccctggcgtcctggtgcccagctcccggggg
ggcctgcccctggaggaggtgaccgtggccgaagtcctggctgcccgaggctacctcaca
ggaatggccggcaagtggcaccttggggtggggcctgagggggccttcctgcccccccat
cagggcttccatcgatttctaggcatcccgtactcccacgaccagggcccctgccagaac
ctgacctgcttcccgccggccactccttgcgacggtggctgtgaccagggcctggtcccc
atcccactgttggccaacctgtccgtggaggcgcagcccccctggctgcccggactagag
gcccgctacatggctttcgcccatgacctcatggccgacgcccagcgccaggatcgcccc
ttcttcctgtactatgcctctcaccacacccactaccctcagttcagtgggcagagcttt
gcagagcgttcaggccgcgggccatttggggactccctgatggagctggatgcagctgtg
gggaccctgatgacagccataggggacctggggctgcttgaagagacgctggtcatcttc
actgcagacaatggacctgagaccatgcgtatgtcccgaggcggctgctccggtctcttg
cggtgtggaaagggaacgacctacgagggcggtgtccgagagcctgccttggccttctgg
ccaggtcatatcgctcccggcgtgacccacgagctggccagctccctggacctgctgcct
accctggcagccctggctggggccccactgcccaatgtcaccttggatggctttgacctc
agccccctgctgctgggcacaggcaagagccctcggcagtctctcttcttctacccgtcc
tacccagacgaggtccgtggggtttttgctgtgcggactggaaagtacaaggctcacttc
ttcacccagggctctgcccacagtgataccactgcagaccctgcctgccacgcctccagc
tctctgactgctcatgagcccccgctgctctatgacctgtccaaggaccctggtgagaac
tacaacctgctggggggtgtggccggggccaccccagaggtgctgcaagccctgaaacag
cttcagctgctcaaggcccagttagacgcagctgtgaccttcggccccagccaggtggcc
cggggcgaggaccccgccctgcagatctgctgtcatcctggctgcaccccccgcccagct
tgctgccattgcccagatccccatgcctga

DBGET integrated database retrieval system