KEGG   Homo sapiens (human): 4137Help
Entry
4137              CDS       T01001                                 

Gene name
MAPT, DDPAC, FTDP-17, MAPTL, MSTD, MTBT1, MTBT2, PPND, TAU
Definition
microtubule-associated protein tau
Orthology
K04380  
microtubule-associated protein tau
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Alzheimer's disease
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
H00077  
Progressive supranuclear palsy (PSP)
H00078  
Frontotemporal lobar degeneration (FTLD)
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
17q21.1
AA seq 776 aa AA seqDB search
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEG
GRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA
QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPA
AAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK
GQANATRIPAKTPPAPKTPPSSATKQVQRRPPPAGPRSERGEPPKSGDRSGYSSPGSPGT
PGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTEN
LKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSL
GNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAK
TDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccccgccaggagttcgaagtgatggaagatcacgctgggacgtacgggttg
ggggacaggaaagatcaggggggctacaccatgcaccaagaccaagagggtgacacggac
gctggcctgaaagaatctcccctgcagacccccactgaggacggatctgaggaaccgggc
tctgaaacctctgatgctaagagcactccaacagcggaagatgtgacagcacccttagtg
gatgagggagctcccggcaagcaggctgccgcgcagccccacacggagatcccagaagga
accacagctgaagaagcaggcattggagacacccccagcctggaagacgaagctgctggt
cacgtgacccaagagcctgaaagtggtaaggtggtccaggaaggcttcctccgagagcca
ggccccccaggtctgagccaccagctcatgtccggcatgcctggggctcccctcctgcct
gagggccccagagaggccacacgccaaccttcggggacaggacctgaggacacagagggc
ggccgccacgcccctgagctgctcaagcaccagcttctaggagacctgcaccaggagggg
ccgccgctgaagggggcagggggcaaagagaggccggggagcaaggaggaggtggatgaa
gaccgcgacgtcgatgagtcctccccccaagactcccctccctccaaggcctccccagcc
caagatgggcggcctccccagacagccgccagagaagccaccagcatcccaggcttccca
gcggagggtgccatccccctccctgtggatttcctctccaaagtttccacagagatccca
gcctcagagcccgacgggcccagtgtagggcgggccaaagggcaggatgcccccctggag
ttcacgtttcacgtggaaatcacacccaacgtgcagaaggagcaggcgcactcggaggag
catttgggaagggctgcatttccaggggcccctggagaggggccagaggcccggggcccc
tctttgggagaggacacaaaagaggctgaccttccagagccctctgaaaagcagcctgct
gctgctccgcgggggaagcccgtcagccgggtccctcaactcaaagctcgcatggtcagt
aaaagcaaagacgggactggaagcgatgacaaaaaagccaagacatccacacgttcctct
gctaaaaccttgaaaaataggccttgccttagccccaaacaccccactcctggtagctca
gaccctctgatccaaccctccagccctgctgtgtgcccagagccaccttcctctcctaaa
tacgtctcttctgtcacttcccgaactggcagttctggagcaaaggagatgaaactcaag
ggggctgatggtaaaacgaagatcgccacaccgcggggagcagcccctccaggccagaag
ggccaggccaacgccaccaggattccagcaaaaaccccgcccgctccaaagacaccaccc
agctctgcgactaagcaagtccagagaagaccaccccctgcagggcccagatctgagaga
ggtgaacctccaaaatcaggggatcgcagcggctacagcagccccggctccccaggcact
cccggcagccgctcccgcaccccgtcccttccaaccccacccacccgggagcccaagaag
gtggcagtggtccgtactccacccaagtcgccgtcttccgccaagagccgcctgcagaca
gcccccgtgcccatgccagacctgaagaatgtcaagtccaagatcggctccactgagaac
ctgaagcaccagccgggaggcgggaaggtgcagataattaataagaagctggatcttagc
aacgtccagtccaagtgtggctcaaaggataatatcaaacacgtcccgggaggcggcagt
gtgcaaatagtctacaaaccagttgacctgagcaaggtgacctccaagtgtggctcatta
ggcaacatccatcataaaccaggaggtggccaggtggaagtaaaatctgagaagcttgac
ttcaaggacagagtccagtcgaagattgggtccctggacaatatcacccacgtccctggc
ggaggaaataaaaagattgaaacccacaagctgaccttccgcgagaacgccaaagccaag
acagaccacggggcggagatcgtgtacaagtcgccagtggtgtctggggacacgtctcca
cggcatctcagcaatgtctcctccaccggcagcatcgacatggtagactcgccccagctc
gccacgctagctgacgaggtgtctgcctccctggccaagcagggtttgtga

DBGET integrated database retrieval system