KEGG   Homo sapiens (human): 4153Help
Entry
4153              CDS       T01001                                 

Gene name
MBL2, COLEC1, HSMBPC, MBL, MBL2D, MBP, MBP-C, MBP1, MBPD
Definition
mannose-binding lectin (protein C) 2, soluble
Orthology
K03991  
mannose-binding lectin
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Complement and coagulation cascades
Staphylococcus aureus infection
Disease
H00105  
Mannose-binding lectin pathway component defects
H00342  
Tuberculosis
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
10q11.2
AA seq 248 aa AA seqDB search
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG
EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA
RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE
EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
LAVCEFPI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgtttccatcactccctctccttctcctgagtatggtggcagcgtcttactca
gaaactgtgacctgtgaggatgcccaaaagacctgccctgcagtgattgcctgtagctct
ccaggcatcaacggcttcccaggcaaagatgggcgtgatggcaccaagggagaaaagggg
gaaccaggccaagggctcagaggcttacagggcccccctggaaagttggggcctccagga
aatccagggccttctgggtcaccaggaccaaagggccaaaaaggagaccctggaaaaagt
ccggatggtgatagtagcctggctgcctcagaaagaaaagctctgcaaacagaaatggca
cgtatcaaaaagtggctcaccttctctctgggcaaacaagttgggaacaagttcttcctg
accaatggtgaaataatgacctttgaaaaagtgaaggccttgtgtgtcaagttccaggcc
tctgtggccacccccaggaatgctgcagagaatggagccattcagaatctcatcaaggag
gaagccttcctgggcatcactgatgagaagacagaagggcagtttgtggatctgacagga
aatagactgacctacacaaactggaacgagggtgaacccaacaatgctggttctgatgaa
gattgtgtattgctactgaaaaatggccagtggaatgacgtcccctgctccacctcccat
ctggccgtctgtgagttccctatctga

DBGET integrated database retrieval system