KEGG   Homo sapiens (human): 4282Help
Entry
4282              CDS       T01001                                 

Gene name
MIF, GIF, GLIF, MMIF
Definition
macrophage migration inhibitory factor (glycosylation-inhibiting factor) (EC:5.3.3.12 5.3.2.1)
Orthology
K07253  
phenylpyruvate tautomerase [EC:5.3.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    4282 (MIF)
   00360 Phenylalanine metabolism
    4282 (MIF)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.1  phenylpyruvate tautomerase
     4282 (MIF)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4282 (MIF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
22q11.23
AA seq 115 aa AA seqDB search
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgttcatcgtaaacaccaacgtgccccgcgcctccgtgccggacgggttcctc
tccgagctcacccagcagctggcgcaggccaccggcaagcccccccagtacatcgcggtg
cacgtggtcccggaccagctcatggccttcggcggctccagcgagccgtgcgcgctctgc
agcctgcacagcatcggcaagatcggcggcgcgcagaaccgctcctacagcaagctgctg
tgcggcctgctggccgagcgcctgcgcatcagcccggacagggtctacatcaactattac
gacatgaacgcggccaatgtgggctggaacaactccaccttcgcctaa

DBGET integrated database retrieval system