KEGG   Homo sapiens (human): 4306Help
Entry
4306              CDS       T01001                                 

Gene name
NR3C2, MCR, MLR, MR, NR3C2VIT
Definition
nuclear receptor subfamily 3, group C, member 2
Orthology
K08555  
mineralocorticoid receptor
Organism
hsa  Homo sapiens (human)
Pathway
Aldosterone-regulated sodium reabsorption
Disease
H00243  
Hyperkalemic distal renal tubular acidosis (RTA type 4)
H00603  
Hypertension exacerbated in pregnancy
Drug target
Spironolactone: 
Potassium canrenoate: 
Canrenone: 
Eplerenone: 
Aldosterone: 
Desoxycortone: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    4306 (NR3C2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    4306 (NR3C2)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   4306 (NR3C2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4q31.1
AA seq 984 aa AA seqDB search
METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYE
QQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAV
VKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPN
VENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSP
ANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVP
SPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD
SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSAR
DQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVN
TALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQV
VKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM
HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYI
KELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAML
VEIISDQLPKVESGNAKPLYFHRK
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atggagaccaaaggctaccacagtctccctgaaggtctagatatggaaagacggtggggt
caagtttctcaggctgtggagcgttcttccctgggacctacagagaggaccgatgagaat
aactacatggagattgtcaacgtaagctgtgtttccggtgctattccaaacaacagtact
caaggaagcagcaaagaaaaacaagaactactcccttgccttcagcaagacaataatcgg
cctgggattttaacatctgatattaaaactgagctggaatctaaggaactttcagcaact
gtagctgagtccatgggtttatatatggattctgtaagagatgctgactattcctatgag
cagcagaaccaacaaggaagcatgagtccagctaagatttatcagaatgttgaacagctg
gtgaaattttacaaaggaaatggccatcgtccttccactctaagttgtgtgaacacgccc
ttgagatcatttatgtctgactctgggagctccgtgaatggtggcgtcatgcgcgccgtt
gttaaaagccctatcatgtgtcatgagaaaagcccgtctgtttgcagccctctgaacatg
acatcttcggtttgcagccctgctggaatcaactctgtgtcctccaccacagccagcttt
ggcagttttccagtgcacagcccaatcacccagggaactcctctgacatgctcccctaat
gttgaaaatcgaggctccaggtcgcacagccctgcacatgctagcaatgtgggctctcct
ctctcaagtccgttaagtagcatgaaatcctcaatttccagccctccaagtcactgcagt
gtaaaatctccagtctccagtcccaataatgtcactctgagatcctctgtgtctagccct
gcaaatattaacaactcaaggtgctctgtttccagcccttcgaacactaataacagatcc
acgctttccagtccggcagccagtactgtgggatctatctgtagccctgtaaacaatgcc
ttcagctacactgcttctggcacctctgctggatccagtacattgcgggatgtggttccc
agtccagacacgcaggagaaaggtgctcaagaggtcccttttcctaagactgaggaagta
gagagtgccatctcaaatggtgtgactggccagcttaatattgtccagtacataaaacca
gaaccagatggagcttttagcagctcatgtctaggaggaaatagcaaaataaattcggat
tcttcattctcagtaccaataaagcaagaatcaaccaagcattcatgttcaggcacctct
tttaaagggaatccaacagtaaacccgtttccatttatggatggctcgtatttttccttt
atggatgataaagactattattccctatcaggaattttaggaccacctgtgcccggcttt
gatggtaactgtgaaggcagcggattcccagtgggtattaaacaagaaccagatgatggg
agctattacccagaggccagcatcccttcctctgctattgttggggtgaattcaggtgga
cagtccttccactacaggattggtgctcaaggtacaatatctttatcacgatcggctaga
gaccaatctttccaacacctgagttcctttcctcctgtcaatactttagtggagtcatgg
aaatcacacggcgacctgtcgtctagaagaagtgatgggtatccggtcttagaatacatt
ccagaaaatgtatcaagctctactttacgaagtgtttctactggatcttcaagaccttca
aaaatatgtttggtgtgtggggatgaggcttcaggatgccattatggggtagtcacctgt
ggcagctgcaaagttttcttcaaaagagcagtggaagggcaacacaactatttatgtgct
ggaagaaatgattgcatcattgataagattcgacgaaagaattgtcctgcttgcagactt
cagaaatgtcttcaagctggaatgaatttaggagcacgaaagtcaaagaagttgggaaag
ttaaaagggattcacgaggagcagccacagcagcagcagcccccacccccacccccaccc
ccgcaaagcccagaggaagggacaacgtacatcgctcctgcaaaagaaccctcggtcaac
acagcactggttcctcagctctccacaatctcacgagcgctcacaccttcccccgttatg
gtccttgaaaacattgaacctgaaattgtatatgcaggctatgacagctcaaaaccagat
acagccgaaaatctgctctccacgctcaaccgcttagcaggcaaacagatgatccaagtc
gtgaagtgggcaaaggtacttccaggatttaaaaacttgcctcttgaggaccaaattacc
ctaatccagtattcttggatgtgtctatcatcatttgccttgagctggagatcgtacaaa
catacgaacagccaatttctctattttgcaccagacctagtctttaatgaagagaagatg
catcagtctgccatgtatgaactatgccaggggatgcaccaaatcagccttcagttcgtt
cgactgcagctcacctttgaagaatacaccatcatgaaagttttgctgctactaagcaca
attccaaaggatggcctcaaaagccaggctgcatttgaagaaatgaggacaaattacatc
aaagaactgaggaagatggtaactaagtgtcccaacaattctgggcagagctggcagagg
ttctaccaactgaccaagctgctggactccatgcatgacctggtgagcgacctgctggaa
ttctgcttctacaccttccgagagtcccatgcgctgaaggtagagttccccgcaatgctg
gtggagatcatcagcgaccagctgcccaaggtggagtcggggaacgccaagccgctctac
ttccaccggaagtga

DBGET integrated database retrieval system