KEGG   Homo sapiens (human): 440138Help
Entry
440138            CDS       T01001                                 

Gene name
ALG11, CDG1P, GT8
Definition
ALG11, alpha-1,2-mannosyltransferase (EC:2.4.1.131)
Orthology
K03844  
alpha-1,2-mannosyltransferase [EC:2.4.1.131]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan precursor biosynthesis
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    440138 (ALG11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.131  GDP-Man:Man3GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase
     440138 (ALG11)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   440138 (ALG11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
13q14.2
AA seq 492 aa AA seqDB search
MAAGERSWCLCKLLRFFYSLFFPGLIVCGTLCVCLVIVLWGIRLLLQRKKKLVSTSKNGK
NQMVIAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDVNVNGQQILEGAFRRF
NIRLIHPVQFVFLRKRYLVEDSLYPHFTLLGQSLGSIFLGWEALMQCVPDVYIDSMGYAF
TLPLFKYIGGCQVGSYVHYPTISTDMLSVVKNQNIGFNNAAFITRNPFLSKVKLIYYYLF
AFIYGLVGSCSDVVMVNSSWTLNHILSLWKVGNCTNIVYPPCDVQTFLDIPLHEKKMTPG
HLLVSVGQFRPEKNHPLQIRAFAKLLNKKMVESPPSLKLVLIGGCRNKDDELRVNQLRRL
SEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSG
GPKLDIVVPHEGDITGFLAESEEDYAETIAHILSMSAEKRLQIRKSARASVSRFSDQEFE
VTFLSSVEKLFK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggcgaaaggagctggtgcctgtgcaagttgttgaggtttttttattcatta
ttcttccctgggctcattgtatgtggaactttatgtgtgtgtttggtcattgtcctttgg
ggaatcagactgctgctacagagaaagaaaaaattagtgtcaactagcaaaaatgggaaa
aatcaaatggtgattgcattttttcatccatactgcaatgctggtggaggaggagaaaga
gttttatggtgtgctttaagagccctgcagaaaaagtatcctgaagcagtttatgttgtt
tataccggcgatgttaatgtcaacggtcaacagatactagaaggtgctttcagaagattt
aacatcagattaattcacccagtgcagtttgtttttttaaggaaacgctatcttgtggaa
gattcactgtatcctcacttcacactgctgggccaaagtctaggatccatttttcttggc
tgggaagctctaatgcagtgtgttcctgatgtttacattgattcaatgggatacgctttt
acgcttcctctgtttaagtatatagggggttgccaagttggaagctatgttcattatcct
actatcagcaccgacatgctctctgtagtgaagaatcaaaatattggatttaataatgca
gccttcattaccaggaatccttttctcagcaaagtaaagctcatctactactatttattt
gcttttatttatggacttgttggttcttgcagtgatgtagtcatggtcaattcttcttgg
acactaaaccatattctctcactatggaaagttgggaattgcactaacattgtttatcca
ccttgtgatgtgcagacatttctggacattcccttacatgagaaaaagatgaccccagga
catttgctggtttctgttggccagtttaggccggaaaagaatcatccattgcagatcaga
gcctttgctaaattgctgaataagaagatggttgagtcacctccttcgcttaaacttgtc
ctcattggaggttgtcgtaacaaagatgatgaacttagggtaaaccaactgagaaggctg
tctgaggatttaggagttcaagaatatgtggaatttaaaataaacattccatttgatgaa
ttaaagaattatttgtctgaagcaacaattggtctgcataccatgtggaacgagcatttt
gggattggagttgtggagtgtatggcagctggcacaattatccttgcacacaattcgggg
ggcccaaagcttgacattgtggttcctcacgaaggagatataactggctttctggctgag
agtgaagaagactatgctgaaactatcgctcacattctttccatgtctgcagaaaagaga
ctccaaatcagaaaaagtgctcgtgcatctgtaagcagattctctgatcaggaatttgaa
gtgacattcctatcatctgtggaaaagttatttaagtaa

DBGET integrated database retrieval system