KEGG   Homo sapiens (human): 4488Help
Entry
4488              CDS       T01001                                 

Gene name
MSX2, CRS2, FPP, HOX8, MSH, PFM, PFM1
Definition
msh homeobox 2
Orthology
K09341  
homeobox protein MSX
Organism
hsa  Homo sapiens (human)
Pathway
HTLV-I infection
Disease
H00458  
Craniosynostosis
H00475  
Enlarged parietal foramina/cranium bifidum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    4488 (MSX2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Msh
    4488 (MSX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
5q35.2
AA seq 267 aa AA seqDB search
MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPK
EASPLPAESASAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPG
RYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLN
LTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSSFSLPFPISSPLQAASIYGASY
PFHRPVLPIPPVGLYATPVGYGMYHLS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccgtccaaaggcaatgacttgttttcgcccgacgaggagggcccagcagtg
gtggccggaccaggcccggggcctgggggcgccgagggggccgcggaggagcgccgcgtc
aaggtctccagcctgcccttcagcgtggaggcgctcatgtccgacaagaagccgcccaag
gaggcgtccccgctgccggccgaaagcgcctcggccggggccaccctgcggccactgctg
ctgtcggggcacggcgctcgggaagcgcacagccccgggccgctggtgaagcccttcgag
accgcctcggtcaagtcggaaaattcagaagatggagcggcgtggatgcaggaacccggc
cgatattcgccgccgccaagacatatgagccctaccacctgcaccctgaggaaacacaag
accaatcggaagccgcgcacgccctttaccacatcccagctcctcgccctggagcgcaag
ttccgtcagaaacagtacctctccattgcagagcgtgcagagttctccagctctctgaac
ctcacagagacccaggtcaaaatctggttccagaaccgaagggccaaggcgaaaagactg
caggaggcagaactggaaaagctgaaaatggctgcaaaacctatgctgccctccagcttc
agtctccctttccccatcagctcgcccctgcaggcagcgtccatatatggagcatcctac
ccgttccatagacctgtgcttcccatcccgcctgtgggactctatgccacgccagtggga
tatggcatgtaccacctgtcctaa

DBGET integrated database retrieval system