KEGG   Homo sapiens (human): 4512Help
Entry
4512              CDS       T01001                                 

Gene name
COX1, COI, MTCO1, MT-CO1
Definition
cytochrome c oxidase subunit I
Orthology
K02256  
cytochrome c oxidase subunit 1 [EC:1.9.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Disease
H00068  
Leber optic atrophy
H01368  
Cytochrome c oxidase (COX) deficiency
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:hsa04260]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
LinkDB All DBs
Position
MT
AA seq 513 aa AA seqDB search
MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTA
HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEA
GAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQ
TPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLAN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIG
VNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKR
KVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccgaccgttgactattctctacaaaccacaaagacattggaacactataccta
ttattcggcgcatgagctggagtcctaggcacagctctaagcctccttattcgagccgag
ctgggccagccaggcaaccttctaggtaacgaccacatctacaacgttatcgtcacagcc
catgcatttgtaataatcttcttcatagtaatacccatcataatcggaggctttggcaac
tgactagttcccctaataatcggtgcccccgatatggcgtttccccgcataaacaacata
agcttctgactcttacctccctctctcctactcctgctcgcatctgctatagtggaggcc
ggagcaggaacaggttgaacagtctaccctcccttagcagggaactactcccaccctgga
gcctccgtagacctaaccatcttctccttacacctagcaggtgtctcctctatcttaggg
gccatcaatttcatcacaacaattatcaatataaaaccccctgccataacccaataccaa
acgcccctcttcgtctgatccgtcctaatcacagcagtcctacttctcctatctctccca
gtcctagctgctggcatcactatactactaacagaccgcaacctcaacaccaccttcttc
gaccccgccggaggaggagaccccattctataccaacacctattctgatttttcggtcac
cctgaagtttatattcttatcctaccaggcttcggaataatctcccatattgtaacttac
tactccggaaaaaaagaaccatttggatacataggtatggtctgagctatgatatcaatt
ggcttcctagggtttatcgtgtgagcacaccatatatttacagtaggaatagacgtagac
acacgagcatatttcacctccgctaccataatcatcgctatccccaccggcgtcaaagta
tttagctgactcgccacactccacggaagcaatatgaaatgatctgctgcagtgctctga
gccctaggattcatctttcttttcaccgtaggtggcctgactggcattgtattagcaaac
tcatcactagacatcgtactacacgacacgtactacgttgtagcccacttccactatgtc
ctatcaataggagctgtatttgccatcataggaggcttcattcactgatttcccctattc
tcaggctacaccctagaccaaacctacgccaaaatccatttcactatcatattcatcggc
gtaaatctaactttcttcccacaacactttctcggcctatccggaatgccccgacgttac
tcggactaccccgatgcatacaccacatgaaacatcctatcatctgtaggctcattcatt
tctctaacagcagtaatattaataattttcatgatttgagaagccttcgcttcgaagcga
aaagtcctaatagtagaagaaccctccataaacctggagtgactatatggatgcccccca
ccctaccacacattcgaagaacccgtatacataaaatctaga

DBGET integrated database retrieval system