KEGG   Homo sapiens (human): 4535Help
Entry
4535              CDS       T01001                                 

Gene name
ND1, MTND1, MT-ND1
Definition
NADH dehydrogenase, subunit 1 (complex I)
Orthology
K03878  
NADH-ubiquinone oxidoreductase chain 1 [EC:1.6.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Parkinson's disease
Module
NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  
Leber optic atrophy
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
H01347  
MELAS Syndrome
H01365  
Leber hereditary optic neuropathy and dystonia (LDYT)
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
LinkDB All DBs
Position
MT
AA seq 318 aa AA seqDB search
MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEP
LKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSG
WASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWP
LAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTT
IFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLAL
LMWYVSMPITISSIPPQT
NT seq 956 nt NT seq  +upstreamnt  +downstreamnt
atacccatggccaacctcctactcctcattgtacccattctaatcgcaatggcattccta
atgcttaccgaacgaaaaattctaggctatatacaactacgcaaaggccccaacgttgta
ggcccctacgggctactacaacccttcgctgacgccataaaactcttcaccaaagagccc
ctaaaacccgccacatctaccatcaccctctacatcaccgccccgaccttagctctcacc
atcgctcttctactatgaacccccctccccatacccaaccccctggtcaacctcaaccta
ggcctcctatttattctagccacctctagcctagccgtttactcaatcctctgatcaggg
tgagcatcaaactcaaactacgccctgatcggcgcactgcgagcagtagcccaaacaatc
tcatatgaagtcaccctagccatcattctactatcaacattactaataagtggctccttt
aacctctccacccttatcacaacacaagaacacctctgattactcctgccatcatgaccc
ttggccataatatgatttatctccacactagcagagaccaaccgaacccccttcgacctt
gccgaaggggagtccgaactagtctcaggcttcaacatcgaatacgccgcaggccccttc
gccctattcttcatagccgaatacacaaacattattataataaacaccctcaccactaca
atcttcctaggaacaacatatgacgcactctcccctgaactctacacaacatattttgtc
accaagaccctacttctaacctccctgttcttatgaattcgaacagcatacccccgattc
cgctacgaccaactcatacacctcctatgaaaaaacttcctaccactcaccctagcatta
cttatatgatatgtctccatacccattacaatctccagcattccccctcaaaccta

DBGET integrated database retrieval system