KEGG   Homo sapiens (human): 4536Help
Entry
4536              CDS       T01001                                 

Gene name
ND2, MTND2, MT-ND2
Definition
MTND2
Orthology
K03879  
NADH-ubiquinone oxidoreductase chain 2 [EC:1.6.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Parkinson's disease
Module
NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  
Leber optic atrophy
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4536 (ND2)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    4536 (ND2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4536 (ND2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4536 (ND2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
LinkDB All DBs
Position
MT
AA seq 347 aa AA seqDB search
MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYF
LTQATASMILLMAILFNNMLSGQWTMTNTTNQYSSLMIMMAMAMKLGMAPFHFWVPEVTQ
GTPLTSGLLLLTWQKLAPISIMYQISPSLNVSLLLTLSILSIMAGSWGGLNQTQLRKILA
YSSITHMGWMMAVLPYNPNMTILNLTIYIILTTTAFLLLNLNSSTTTLLLSRTWNKLTWL
TPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSLIIPTIMATITLLNLYFYLRLIYST
SITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL
NT seq 1042 nt NT seq  +upstreamnt  +downstreamnt
attaatcccctggcccaacccgtcatctactctaccatctttgcaggcacactcatcaca
gcgctaagctcgcactgattttttacctgagtaggcctagaaataaacatgctagctttt
attccagttctaaccaaaaaaataaaccctcgttccacagaagctgccatcaagtatttc
ctcacgcaagcaaccgcatccataatccttctaatagctatcctcttcaacaatatactc
tccggacaatgaaccataaccaatactaccaatcaatactcatcattaataatcataata
gctatagcaataaaactaggaatagccccctttcacttctgagtcccagaggttacccaa
ggcacccctctgacatccggcctgcttcttctcacatgacaaaaactagcccccatctca
atcatataccaaatctctccctcactaaacgtaagccttctcctcactctctcaatctta
tccatcatagcaggcagttgaggtggattaaaccaaacccagctacgcaaaatcttagca
tactcctcaattacccacataggatgaataatagcagttctaccgtacaaccctaacata
accattcttaatttaactatttatattatcctaactactaccgcattcctactactcaac
ttaaactccagcaccacgaccctactactatctcgcacctgaaacaagctaacatgacta
acacccttaattccatccaccctcctctccctaggaggcctgcccccgctaaccggcttt
ttgcccaaatgggccattatcgaagaattcacaaaaaacaatagcctcatcatccccacc
atcatagccaccatcaccctccttaacctctacttctacctacgcctaatctactccacc
tcaatcacactactccccatatctaacaacgtaaaaataaaatgacagtttgaacataca
aaacccaccccattcctccccacactcatcgcccttaccacgctactcctacctatctcc
ccttttatactaataatcttat

DBGET integrated database retrieval system