KEGG   Homo sapiens (human): 4538Help
Entry
4538              CDS       T01001                                 

Gene name
ND4, MTND4, MT-ND4, LHON
Definition
NADH dehydrogenase, subunit 4 (complex I)
Orthology
K03881  
NADH-ubiquinone oxidoreductase chain 4 [EC:1.6.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Parkinson's disease
Module
NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  
Leber optic atrophy
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
H01355  
Kearns-Sayre Syndrome
H01365  
Leber hereditary optic neuropathy and dystonia (LDYT)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4538 (ND4)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    4538 (ND4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4538 (ND4)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4538 (ND4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
LinkDB All DBs
Position
MT
AA seq 459 aa AA seqDB search
MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDP
LTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYI
FFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLT
LTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGG
YGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSICLRQTDLKSLIAYSSISHMALVVTA
ILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWL
LASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLT
HHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS
NT seq 1378 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaactaatcgtcccaacaattatattactaccactgacatgactttccaaaaaa
cacataatttgaatcaacacaaccacccacagcctaattattagcatcatccctctacta
ttttttaaccaaatcaacaacaacctatttagctgttccccaaccttttcctccgacccc
ctaacaacccccctcctaatactaactacctgactcctacccctcacaatcatggcaagc
caacgccacttatccagtgaaccactatcacgaaaaaaactctacctctctatactaatc
tccctacaaatctccttaattataacattcacagccacagaactaatcatattttatatc
ttcttcgaaaccacacttatccccaccttggctatcatcacccgatgaggcaaccagcca
gaacgcctgaacgcaggcacatacttcctattctacaccctagtaggctcccttccccta
ctcatcgcactaatttacactcacaacaccctaggctcactaaacattctactactcact
ctcactgcccaagaactatcaaactcctgagccaacaacttaatatgactagcttacaca
atagcttttatagtaaagatacctctttacggactccacttatgactccctaaagcccat
gtcgaagcccccatcgctgggtcaatagtacttgccgcagtactcttaaaactaggcggc
tatggtataatacgcctcacactcattctcaaccccctgacaaaacacatagcctacccc
ttccttgtactatccctatgaggcataattataacaagctccatctgcctacgacaaaca
gacctaaaatcgctcattgcatactcttcaatcagccacatagccctcgtagtaacagcc
attctcatccaaaccccctgaagcttcaccggcgcagtcattctcataatcgcccacggg
cttacatcctcattactattctgcctagcaaactcaaactacgaacgcactcacagtcgc
atcataatcctctctcaaggacttcaaactctactcccactaatagctttttgatgactt
ctagcaagcctcgctaacctcgccttaccccccactattaacctactgggagaactctct
gtgctagtaaccacgttctcctgatcaaatatcactctcctacttacaggactcaacata
ctagtcacagccctatactccctctacatatttaccacaacacaatggggctcactcacc
caccacattaacaacataaaaccctcattcacacgagaaaacaccctcatgttcatacac
ctatcccccattctcctcctatccctcaaccccgacatcattaccgggttttcctctt

DBGET integrated database retrieval system