KEGG   Homo sapiens (human): 4538Help
Entry
4538              CDS       T01001                                 

Gene name
ND4, MTND4, MT-ND4, LHON
Definition
(RefSeq) NADH dehydrogenase, subunit 4 (complex I)
  KO
K03881  NADH-ubiquinone oxidoreductase chain 4 [EC:1.6.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa05012  Parkinson's disease
Module
hsa_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  Leber hereditary optic atrophy (LHON)
H00473  Mitochondrial respiratory chain deficiencies (MRCD)
H01355  Kearns-Sayre syndrome
H01365  Leber hereditary optic neuropathy and dystonia (LDYT)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4538 (ND4)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4538 (ND4)
  Environmental adaptation
   04714 Thermogenesis
    4538 (ND4)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    4538 (ND4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4538 (ND4)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4538 (ND4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proton_antipo_M Oxidored_q5_N
Motif
Other DBs
NCBI-GeneID: 4538
NCBI-ProteinID: YP_003024035
OMIM: 516003
HGNC: 7459
Pharos: P03905(Tclin)
UniProt: P03905 H9EC08
LinkDB All DBs
Structure
PDB: 

Jmol
Position
MT
AA seq 459 aa AA seqDB search
MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDP
LTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYI
FFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLT
LTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGG
YGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSICLRQTDLKSLIAYSSISHMALVVTA
ILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWL
LASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLT
HHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS
NT seq 1378 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaactaatcgtcccaacaattatattactaccactgacatgactttccaaaaaa
cacataatttgaatcaacacaaccacccacagcctaattattagcatcatccctctacta
ttttttaaccaaatcaacaacaacctatttagctgttccccaaccttttcctccgacccc
ctaacaacccccctcctaatactaactacctgactcctacccctcacaatcatggcaagc
caacgccacttatccagtgaaccactatcacgaaaaaaactctacctctctatactaatc
tccctacaaatctccttaattataacattcacagccacagaactaatcatattttatatc
ttcttcgaaaccacacttatccccaccttggctatcatcacccgatgaggcaaccagcca
gaacgcctgaacgcaggcacatacttcctattctacaccctagtaggctcccttccccta
ctcatcgcactaatttacactcacaacaccctaggctcactaaacattctactactcact
ctcactgcccaagaactatcaaactcctgagccaacaacttaatatgactagcttacaca
atagcttttatagtaaagatacctctttacggactccacttatgactccctaaagcccat
gtcgaagcccccatcgctgggtcaatagtacttgccgcagtactcttaaaactaggcggc
tatggtataatacgcctcacactcattctcaaccccctgacaaaacacatagcctacccc
ttccttgtactatccctatgaggcataattataacaagctccatctgcctacgacaaaca
gacctaaaatcgctcattgcatactcttcaatcagccacatagccctcgtagtaacagcc
attctcatccaaaccccctgaagcttcaccggcgcagtcattctcataatcgcccacggg
cttacatcctcattactattctgcctagcaaactcaaactacgaacgcactcacagtcgc
atcataatcctctctcaaggacttcaaactctactcccactaatagctttttgatgactt
ctagcaagcctcgctaacctcgccttaccccccactattaacctactgggagaactctct
gtgctagtaaccacgttctcctgatcaaatatcactctcctacttacaggactcaacata
ctagtcacagccctatactccctctacatatttaccacaacacaatggggctcactcacc
caccacattaacaacataaaaccctcattcacacgagaaaacaccctcatgttcatacac
ctatcccccattctcctcctatccctcaaccccgacatcattaccgggttttcctctt

DBGET integrated database retrieval system