KEGG   Homo sapiens (human): 4591Help
Entry
4591              CDS       T01001                                 

Gene name
TRIM37, MUL, POB1, TEF3
Definition
tripartite motif containing 37
Orthology
K10608  
tripartite motif-containing protein 37 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Disease
H01289  
Mulibrey nanism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4591 (TRIM37)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     4591 (TRIM37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
17q23.2
AA seq 964 aa AA seqDB search
MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQL
RELVNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALW
GGMHGGHTFKPLAEIYEQHVTKVNEEVAKLRRRLMELISLVQEVERNVEAVRNAKDERVR
EIRNAVEMMIARLDTQLKNKLITLMGQKTSLTQETELLESLLQEVEHQLRSCSKSELISK
SSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSATFVLENFSTLRQRADPVYSPP
LQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQSCNDPTKNII
REFASDFEVGECWGYNRFFRLDLLANEGYLNPQNDTVILRFQVRSPTFFQKSRDQHWYIT
QLEAAQTSYIQQINNLKERLTIELSRTQKSRDLSPPDNHLSPQNDDALETRAKKSACSDM
LLEGGPTTASVREAKEDEEDEEKIQNEDYHHELSDGDLDLDLVYEDEVNQLDGSSSSASS
TATSNTEENDIDEETMSGENDVEYNNMELEEGELMEDAAAAGPAGSSHGYVGSSSRISRR
THLCSAATSSLLDIDPLILIHLLDLKDRSSIENLWGLQPRPPASLLQPTASYSRKDKDQR
KQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKNTLSEIKSSSAASGDMQTSLFSADQAA
LAACGTENSGRLQDLGMELLAKSSVANCYIRNSTNKKSNSPKPARSSVAGSLSLRRAVDP
GENSRSKGDCQTLSEGSPGSSQSGSRHSSPRALIHGSIGDILPKTEDRQCKALDSDAVVV
AVFSGLPAVEKRRKMVTLGANAKGGHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGM
SSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDE
NSGR
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacagagcgtggagagcattgctgaggttttccgatgtttcatttgtatggag
aaattgcgggatgcacgcctgtgtcctcattgctccaaactgtgttgtttcagctgtatt
aggcgctggctgacagagcagagagctcaatgtcctcattgccgtgctccactccagcta
cgagaactagtaaattgtcgttgggcagaagaagtaacacaacagcttgatactcttcaa
ctctgcagtctcaccaaacatgaagaaaatgaaaaggacaaatgtgaaaatcaccatgaa
aaacttagtgtattttgctggacttgtaagaagtgtatctgccatcagtgtgcactttgg
ggaggaatgcatggcggacatacctttaaacctttggcagaaatttatgagcaacacgtc
actaaagtgaatgaagaggtagccaaacttcgtcggcgtctcatggaactgatcagctta
gttcaagaagtggaaaggaatgtagaagctgtaagaaatgcaaaagatgagcgtgttcgg
gaaattaggaatgcagtggagatgatgattgcacggttagacacacagctgaagaataag
cttataacactgatgggtcagaagacatctctaacccaagaaacagagcttttggaatcc
ttacttcaggaggtggagcaccagttgcggtcttgtagtaagagtgagttgatatctaag
agctcagagatccttatgatgtttcagcaagttcatcggaagcccatggcatcttttgtt
accactcctgttccaccagactttaccagtgaattagtgccatcttacgattcagctact
tttgttttagagaatttcagcactttgcgtcagagagcagatcctgtttacagtccacct
cttcaagtttcaggactttgctggaggttaaaagtttacccagatggaaatggagttgtg
cgaggttactacttatctgtgtttctggagctctcagctggcttgcctgaaacttctaaa
tatgaatatcgtgtagagatggttcaccagtcctgtaatgatcctacaaaaaatatcatt
cgagaatttgcatctgactttgaagttggagaatgctggggctataatagatttttccgt
ttggacttactcgcaaatgaaggatacttgaatccacaaaatgatacagtgattttaagg
tttcaggtacgttcaccaactttctttcaaaaatcccgggaccagcattggtacattact
cagttggaagctgcacagactagttatatccaacaaataaacaaccttaaagagagactt
actattgagctgtctcgaactcagaagtcaagagatttgtcaccaccagataaccatctt
agcccccaaaatgatgatgctctggagacacgagctaagaagtctgcatgctctgacatg
cttctcgaaggtggtcctactacagcttctgtaagagaggccaaagaggatgaagaagat
gaggagaagattcagaatgaagattatcatcacgagctttcagatggagatctggatctg
gatcttgtttatgaggatgaagtaaatcagctcgatggcagcagttcctctgctagttcc
acagcaacaagtaatacagaagaaaatgatattgatgaagaaactatgtctggagaaaat
gatgtggaatataacaacatggaattagaagagggagaactcatggaagatgcagctgct
gcaggacccgcaggtagtagccatggttatgtgggttccagtagtagaatatcaagaaga
acacatttatgctccgctgctaccagtagtttactagacattgatccattaattttaata
catttgttggaccttaaggaccggagcagtatagaaaatttgtggggcttacagcctcgc
ccacctgcttcacttctgcagcccacagcatcatattctcgaaaagataaagaccaaagg
aagcaacaggcaatgtggcgagtgccctctgatttaaagatgctaaaaagactcaaaact
caaatggccgaagttcgatgtatgaaaactgatgtaaagaatacactttcagaaataaaa
agcagcagtgctgcttctggagacatgcagacaagccttttttctgctgaccaggcagct
ctggctgcatgtggaactgaaaactctggcagattgcaggatttgggaatggaactcctg
gcaaagtcatcagttgccaattgttacatacgaaactccacaaataagaagagtaattcg
cccaagccagctcgatccagtgtagcaggtagtctatcacttcgaagagcagtggaccct
ggagaaaatagtcgttcaaagggagactgtcagactctgtctgaaggctccccaggaagc
tctcagtctgggagcaggcacagttctccccgagccttgatacatggcagtatcggtgat
attctgccaaaaactgaagaccggcagtgtaaagctttggattcagatgctgttgtggtt
gcagttttcagtggcttgcctgcggttgagaaaaggaggaaaatggtcaccttgggggct
aatgctaaaggaggtcatctggaaggactgcagatgactgatttggaaaataattctgaa
actggagagttacagcctgtactacctgaaggagcttcagctgcccctgaagaaggaatg
agtagcgacagtgacattgaatgtgacactgagaatgaggagcaggaagagcataccagt
gtgggcgggtttcacgactccttcatggtcatgacacagcccccggatgaagatacacat
tccagttttcctgatggtgaacaaataggccctgaagatctcagcttcaatacagatgaa
aatagtggaagataa

DBGET integrated database retrieval system