KEGG   Homo sapiens (human): 4627Help
Entry
4627              CDS       T01001                                 

Gene name
MYH9, BDPLT6, DFNA17, EPSTS, FTNS, MHA, NMHC-II-A, NMMHC-IIA, NMMHCA
Definition
myosin, heavy chain 9, non-muscle
Orthology
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Regulation of actin cytoskeleton
Salmonella infection
Disease
H00233  
Macrothrombocytopenia
H00578  
MYH9-related kidney diseases
H00604  
Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    4627 (MYH9)
  Cellular commiunity
   04530 Tight junction
    4627 (MYH9)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    4627 (MYH9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4627 (MYH9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 1960 aa AA seqDB search
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK
FNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCL
ETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLK
DLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGT
VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQ
YKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
NT seq 5883 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcaagctgccgataagtatctctatgtggataaaaacttcatcaacaatccg
ctggcccaggccgactgggctgccaagaagctggtatgggtgccttccgacaagagtggc
tttgagccagccagcctcaaggaggaggtgggcgaagaggccatcgtggagctggtggag
aatgggaagaaggtgaaggtgaacaaggatgacatccagaagatgaacccgcccaagttc
tccaaggtggaggacatggcagagctcacgtgcctcaacgaagcctcggtgctgcacaac
ctcaaggagcgttactactcagggctcatctacacctattcaggcctgttctgtgtggtc
atcaatccttacaagaacctgcccatctactctgaagagattgtggaaatgtacaagggc
aagaagaggcacgagatgccccctcacatctatgccatcacagacaccgcctacaggagt
atgatgcaagaccgagaagatcaatccatcttgtgcactggtgaatctggagctggcaag
acggagaacaccaagaaggtcatccagtatctggcgtacgtggcgtcctcgcacaagagc
aagaaggaccagggcgagctggagcggcagctgctgcaggccaaccccatcctggaggcc
ttcgggaacgccaagaccgtgaagaatgacaactcctcccgcttcggcaaattcattcgc
atcaactttgatgtcaatggctacattgttggagccaacattgagacttatcttttggag
aaatctcgtgctatccgccaagccaaggaagaacggaccttccacatcttctattatctc
ctgtctggggctggagagcacctgaagaccgatctcctgttggagccgtacaacaaatac
cgcttcctgtccaatggacacgtcaccatccccgggcagcaggacaaggacatgttccag
gagaccatggaggccatgaggattatgggcatcccagaagaggagcaaatgggcctgctg
cgggtcatctcaggggttcttcagctcggcaacatcgtcttcaagaaggagcggaacact
gaccaggcgtccatgcccgacaacacagctgcccaaaaggtgtcccatctcttgggtatc
aatgtgaccgatttcaccagaggaatcctcaccccgcgcatcaaggtgggacgggattac
gtccagaaggcgcagactaaagagcaggctgactttgccatcgaggccttggccaaggcg
acctatgagcggatgttccgctggctggtgctgcgcatcaacaaggctctggacaagacc
aagaggcagggcgcctccttcatcgggatcctggacattgccggcttcgagatctttgat
ctgaactcgtttgagcagctgtgcatcaattacaccaatgagaagctgcagcagctcttc
aaccacaccatgttcatcctggagcaggaggagtaccagcgcgagggcatcgagtggaac
ttcatcgactttggcctcgacctgcagccctgcatcgacctcattgagaagccagcaggc
cccccgggcattctggccctgctggacgaggagtgctggttccccaaagccaccgacaag
agcttcgtggagaaggtgatgcaggagcagggcacccaccccaagttccagaagcccaag
cagctgaaggacaaagctgatttctgcattatccactatgccggcaaggtggattacaaa
gctgacgagtggctgatgaagaacatggatcccctgaatgacaacatcgccacactgctc
caccagtcctctgacaagtttgtctcggagctgtggaaggatgtggaccgcatcatcggc
ctggaccaggtggccggcatgtcggagaccgcactgcccggggccttcaagacgcggaag
ggcatgttccgcactgtggggcagctttacaaggagcagctggccaagctgatggctacg
ctgaggaacacgaaccccaactttgtccgctgcatcatccccaaccacgagaagaaggcc
ggcaagctggacccgcatctcgtgctggaccagctgcgctgcaacggtgttctcgagggc
atccgtatctgccgccagggcttccccaacagggtggtcttccaggagtttcggcagaga
tatgagatcctgactccaaactccattcccaagggtttcatggacgggaagcaggcgtgc
gtgctcatgataaaagccctggagctcgacagcaatctgtaccgcattggccagagcaaa
gtcttcttccgtgccggtgtgctggcccacctggaggaggagcgagacctgaagatcacc
gacgtcatcatagggttccaggcctgctgcaggggctacctggccaggaaagcatttgcc
aagcggcagcagcagcttaccgccatgaaggtcctccagcggaactgcgctgcctacctg
aagctgcggaactggcagtggtggcggctcttcaccaaggtcaagccgctgctgcaggtg
agccggcaggaggaggagatgatggccaaggaggaggagctggtgaaggtcagagagaag
cagctggctgcggagaacaggctcacggagatggagacgctgcagtctcagctcatggca
gagaaattgcagctgcaggagcagctccaggcagaaaccgagctgtgtgccgaggctgag
gagctccgggcccgcctgaccgccaagaagcaggaattagaagagatctgccatgaccta
gaggccagggtggaggaggaggaggagcgctgccagcacctgcaggcggagaagaagaag
atgcagcagaacatccaggagcttgaggagcagctggaggaggaggagagcgcccggcag
aagctgcagctggagaaggtgaccaccgaggcgaagctgaaaaagctggaggaggagcag
atcatcctggaggaccagaactgcaagctggccaaggaaaagaaactgctggaagacaga
atagctgagttcaccaccaacctcacagaagaggaggagaaatctaagagcctcgccaag
ctcaagaacaagcatgaggcaatgatcactgacttggaagagcgcctccgcagggaggag
aagcagcgacaggagctggagaagacccgccggaagctggagggagactccacagacctc
agcgaccagatcgccgagctccaggcccagatcgcggagctcaagatgcagctggccaag
aaagaggaggagctccaggccgccctggccagagtggaagaggaagctgcccagaagaac
atggccctcaagaagatccgggagctggaatctcagatctctgaactccaggaagacctg
gagtctgagcgtgcttccaggaataaagctgagaagcagaaacgggaccttggggaagag
ctagaggctctgaaaacagagttggaggacacgctggattccacagctgcccagcaggag
ctcaggtcaaaacgtgagcaggaggtgaacatcctgaagaagaccctggaggaggaggcc
aagacccacgaggcccagatccaggagatgaggcagaagcactcacaggccgtggaggag
ctggcggagcagctggagcagacgaagcgggtgaaagcaaacctcgagaaggcaaagcag
actctggagaacgagcggggggagctggccaacgaggtgaaggtgctgctgcagggcaaa
ggggactcggagcacaagcgcaagaaagtggaggcgcagctgcaggagctgcaggtcaag
ttcaacgagggagagcgcgtgcgcacagagctggccgacaaggtcaccaagctgcaggtg
gagctggacaacgtgaccgggcttctcagccagtccgacagcaagtccagcaagctcacc
aaggacttctccgcgctggagtcccagctgcaggacactcaggagctgctgcaggaggag
aaccggcagaagctgagcctgagcaccaagctcaagcaggtggaggacgagaagaattcc
ttccgggagcagctggaggaggaggaggaggccaagcacaacctggagaagcagatcgcc
accctccatgcccaggtggccgacatgaaaaagaagatggaggacagtgtggggtgcctg
gaaactgctgaggaggtgaagaggaagctccagaaggacctggagggcctgagccagcgg
cacgaggagaaggtggccgcctacgacaagctggagaagaccaagacgcggctgcagcag
gagctggacgacctgctggtggacctggaccaccagcgccagagcgcgtgcaacctggag
aagaagcagaagaagtttgaccagctcctggcggaggagaagaccatctctgccaagtat
gcagaggagcgcgaccgggctgaggcggaggcccgagagaaggagaccaaggctctgtcg
ctggcccgggccctggaggaagccatggagcagaaggcggagctggagcggctcaacaag
cagttccgcacggagatggaggaccttatgagctccaaggatgatgtgggcaagagtgtc
cacgagctggagaagtccaagcgggccctagagcagcaggtggaggagatgaagacgcag
ctggaagagctggaggacgagctgcaggccaccgaagatgccaagctgcggttggaggtc
aacctgcaggccatgaaggcccagttcgagcgggacctgcagggccgggacgagcagagc
gaggagaagaagaagcagctggtcagacaggtgcgggagatggaggcagagctggaggac
gagaggaagcagcgctcgatggcagtggccgcccggaagaagctggagatggacctgaag
gacctggaggcgcacatcgactcggccaacaagaaccgggacgaagccatcaaacagctg
cggaagctgcaggcccagatgaaggactgcatgcgcgagctggatgacacccgcgcctct
cgtgaggagatcctggcccaggccaaagagaacgagaagaagctgaagagcatggaggcc
gagatgatccagttgcaggaggaactggcagccgcggagcgtgccaagcgccaggcccag
caggagcgggatgagctggctgacgagatcgccaacagcagcggcaaaggagccctggcg
ttagaggagaagcggcgtctggaggcccgcatcgcccagctggaggaggagctggaggag
gagcagggcaacacggagctgatcaacgaccggctgaagaaggccaacctgcagatcgac
cagatcaacaccgacctgaacctggagcgcagccacgcccagaagaacgagaatgctcgg
cagcagctggaacgccagaacaaggagcttaaggtcaagctgcaggagatggagggcact
gtcaagtccaagtacaaggcctccatcaccgccctcgaggccaagattgcacagctggag
gagcagctggacaacgagaccaaggagcgccaggcagcctgcaaacaggtgcgtcggacc
gagaagaagctgaaggatgtgctgctgcaggtggatgacgagcggaggaacgccgagcag
tacaaggaccaggccgacaaggcatctacccgcctgaagcagctcaagcggcagctggag
gaggccgaagaggaggcccagcgggccaacgcctcccgccggaaactgcagcgcgagctg
gaggacgccactgagacggccgatgccatgaaccgcgaagtcagctccctaaagaacaag
ctcaggcgcggggacctgccgtttgtcgtgccccgccgaatggcccggaaaggcgccggg
gatggctccgacgaagaggtagatggcaaagcggatggggctgaggccaaacctgccgaa
taa

DBGET integrated database retrieval system