KEGG   Homo sapiens (human): 4633Help
Entry
4633              CDS       T01001                                 

Gene name
MYL2, CMH10, MLC2
Definition
myosin, light chain 2, regulatory, cardiac, slow
Orthology
K10351  
myosin regulatory light chain 2
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    4633 (MYL2)
  Cellular commiunity
   04510 Focal adhesion
    4633 (MYL2)
   04530 Tight junction
    4633 (MYL2)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    4633 (MYL2)
  Circulatory system
   04260 Cardiac muscle contraction
    4633 (MYL2)
   04261 Adrenergic signaling in cardiomyocytes
    4633 (MYL2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    4633 (MYL2)
   05414 Dilated cardiomyopathy (DCM)
    4633 (MYL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12q24.11
AA seq 166 aa AA seqDB search
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcacctaagaaagcaaagaagagagccgggggcgccaactccaacgtgttctccatg
ttcgaacagacccaaatccaggaatttaaggaggccttcactatcatggaccagaacagg
gatggcttcattgacaagaacgatctgagagacacctttgctgcccttgggcgagtgaac
gtgaaaaatgaagaaattgatgaaatgatcaaggaggctccgggtccaattaactttact
gtgttcctcacaatgtttggggagaaacttaagggagcggaccctgaggaaaccattctc
aacgcattcaaagtgtttgaccctgaaggcaaaggggtgctgaaggctgattacgttcgg
gaaatgctgaccacgcaggcggagaggttttccaaggaggaggttgaccagatgttcgcc
gccttcccccctgacgtgactggcaacttggactacaagaacctggtgcacatcatcacc
cacggagaagagaaggactag

DBGET integrated database retrieval system