KEGG   Homo sapiens (human): 4771Help
Entry
4771              CDS       T01001                                 

Gene name
NF2, ACN, BANF, SCH
Definition
neurofibromin 2 (merlin)
Orthology
K16684  
merlin
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Disease
H00015  
Malignant pleural mesothelioma
H00523  
Noonan syndrome and related disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    4771 (NF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
22q12.2
AA seq 595 aa AA seqDB search
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT
YPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
ELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggccggggccatcgcttcccgcatgagcttcagctctctcaagaggaagcaacccaag
acgttcaccgtgaggatcgtcaccatggacgccgagatggagttcaattgcgagatgaag
tggaaagggaaggacctctttgatttggtgtgccggactctggggctccgagaaacctgg
ttctttggactgcagtacacaatcaaggacacagtggcctggctcaaaatggacaagaag
gtactggatcatgatgtttcaaaggaagaaccagtcacctttcacttcttggccaaattt
tatcctgagaatgctgaagaggagctggttcaggagatcacacaacatttattcttctta
caggtaaagaagcagattttagatgaaaagatctactgccctcctgaggcttctgtgctc
ctggcttcttacgccgtccaggccaagtatggtgactacgaccccagtgttcacaagcgg
ggatttttggcccaagaggaattgcttccaaaaagggtaataaatctgtatcagatgact
ccggaaatgtgggaggagagaattactgcttggtacgcagagcaccgaggccgagccagg
gatgaagctgaaatggaatatctgaagatagctcaggacctggagatgtacggtgtgaac
tactttgcaatccggaataaaaagggcacagagctgctgcttggagtggatgccctgggg
cttcacatttatgaccctgagaacagactgacccccaagatctccttcccgtggaatgaa
atccgaaacatctcgtacagtgacaaggagtttactattaaaccactggataagaaaatt
gatgtcttcaagtttaactcctcaaagcttcgtgttaataagctgattctccagctatgt
atcgggaaccatgatctatttatgaggagaaggaaagccgattctttggaagttcagcag
atgaaagcccaggccagggaggagaaggctagaaagcagatggagcggcagcgcctcgct
cgagagaagcagatgagggaggaggctgaacgcacgagggatgagttggagaggaggctg
ctgcagatgaaagaagaagcaacaatggccaacgaagcactgatgcggtctgaggagaca
gctgacctgttggctgaaaaggcccagatcaccgaggaggaggcaaaacttctggcccag
aaggccgcagaggctgagcaggaaatgcagcgcatcaaggccacagcgattcgcacggag
gaggagaagcgcctgatggagcagaaggtgctggaagccgaggtgctggcactgaagatg
gctgaggagtcagagaggagggccaaagaggcagatcagctgaagcaggacctgcaggaa
gcacgcgaggcggagcgaagagccaagcagaagctcctggagattgccaccaagcccacg
tacccgcccatgaacccaattccagcaccgttgcctcctgacataccaagcttcaacctc
attggtgacagcctgtctttcgacttcaaagatactgacatgaagcggctttccatggag
atagagaaagaaaaagtggaatacatggaaaagagcaagcatctgcaggagcagctcaat
gaactcaagacagaaatcgaggccttgaaactgaaagagagggagacagctctggatatt
ctgcacaatgagaactccgacaggggtggcagcagcaagcacaataccattaaaaagctc
accttgcagagcgccaagtcccgagtggccttctttgaagagctctag

DBGET integrated database retrieval system