KEGG   Homo sapiens (human): 4792Help
Entry
4792              CDS       T01001                                 

Gene name
NFKBIA, IKBA, MAD-3, NFKBI
Definition
nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha
Orthology
K04734  
NF-kappa-B inhibitor alpha
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Adipocytokine signaling pathway
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Prostate cancer
Chronic myeloid leukemia
Small cell lung cancer
Disease
H00007  
Hodgkin lymphoma
H00095  
Ectodermal dysplasia associated immunodeficiency (EDA-ID)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    4792 (NFKBIA)
   04668 TNF signaling pathway
    4792 (NFKBIA)
   04024 cAMP signaling pathway
    4792 (NFKBIA)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    4792 (NFKBIA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    4792 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    4792 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    4792 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    4792 (NFKBIA)
   04660 T cell receptor signaling pathway
    4792 (NFKBIA)
   04662 B cell receptor signaling pathway
    4792 (NFKBIA)
   04062 Chemokine signaling pathway
    4792 (NFKBIA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    4792 (NFKBIA)
  Nervous system
   04722 Neurotrophin signaling pathway
    4792 (NFKBIA)
  Development
   04380 Osteoclast differentiation
    4792 (NFKBIA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4792 (NFKBIA)
   05203 Viral carcinogenesis
    4792 (NFKBIA)
   05220 Chronic myeloid leukemia
    4792 (NFKBIA)
   05215 Prostate cancer
    4792 (NFKBIA)
   05222 Small cell lung cancer
    4792 (NFKBIA)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    4792 (NFKBIA)
   05131 Shigellosis
    4792 (NFKBIA)
   05134 Legionellosis
    4792 (NFKBIA)
   05166 HTLV-I infection
    4792 (NFKBIA)
   05162 Measles
    4792 (NFKBIA)
   05164 Influenza A
    4792 (NFKBIA)
   05161 Hepatitis B
    4792 (NFKBIA)
   05160 Hepatitis C
    4792 (NFKBIA)
   05168 Herpes simplex infection
    4792 (NFKBIA)
   05169 Epstein-Barr virus infection
    4792 (NFKBIA)
   05145 Toxoplasmosis
    4792 (NFKBIA)
   05140 Leishmaniasis
    4792 (NFKBIA)
   05142 Chagas disease (American trypanosomiasis)
    4792 (NFKBIA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    4792 (NFKBIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
14q13
AA seq 317 aa AA seqDB search
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
DELPYDDCVFGGQRLTL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgttccaggcggccgagcgcccccaggagtgggccatggagggcccccgcgacgggctg
aagaaggagcggctactggacgaccgccacgacagcggcctggactccatgaaagacgag
gagtacgagcagatggtcaaggagctgcaggagatccgcctcgagccgcaggaggtgccg
cgcggctcggagccctggaagcagcagctcaccgaggacggggactcgttcctgcacttg
gccatcatccatgaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagcgtg
ggagtcctgactcagtcctgcaccaccccgcacctccactccatcctgaaggctaccaac
tacaatggccacacgtgtctacacttagcctctatccatggctacctgggcatcgtggag
cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccggactgcc
cttcacctcgcagtggacctgcaaaatcctgacctggtgtcactcctgttgaagtgtggg
gctgatgtcaacagagttacctaccagggctattctccctaccagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccagctgacactagaaaaccttcagatgctg
ccagagagtgaggatgaggagagctatgacacagagtcagagttcacggagttcacagag
gacgagctgccctatgatgactgtgtgtttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system