KEGG   Homo sapiens (human): 4803Help
Entry
4803              CDS       T01001                                 

Gene name
NGF, Beta-NGF, HSAN5, NGFB
Definition
nerve growth factor (beta polypeptide)
Orthology
K02582  
nerve growth factor, beta
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Disease
H00265  
Hereditary sensory and autonomic neuropathy (HSAN)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    4803 (NGF)
   04015 Rap1 signaling pathway
    4803 (NGF)
   04010 MAPK signaling pathway
    4803 (NGF)
   04151 PI3K-Akt signaling pathway
    4803 (NGF)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    4803 (NGF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    4803 (NGF)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    4803 (NGF)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    4803 (NGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1p13.1
AA seq 241 aa AA seqDB search
MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIA
ARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSK
RSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCR
DPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRR
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgttgttctacactctgatcacagcttttctgatcggcatacaggcggaacca
cactcagagagcaatgtccctgcaggacacaccatcccccaagcccactggactaaactt
cagcattcccttgacactgcccttcgcagagcccgcagcgccccggcagcggcgatagct
gcacgcgtggcggggcagacccgcaacattactgtggaccccaggctgtttaaaaagcgg
cgactccgttcaccccgtgtgctgtttagcacccagcctccccgtgaagctgcagacact
caggatctggacttcgaggtcggtggtgctgcccccttcaacaggactcacaggagcaag
cggtcatcatcccatcccatcttccacaggggcgaattctcggtgtgtgacagtgtcagc
gtgtgggttggggataagaccaccgccacagacatcaagggcaaggaggtgatggtgttg
ggagaggtgaacattaacaacagtgtattcaaacagtacttttttgagaccaagtgccgg
gacccaaatcccgttgacagcgggtgccggggcattgactcaaagcactggaactcatat
tgtaccacgactcacacctttgtcaaggcgctgaccatggatggcaagcaggctgcctgg
cggtttatccggatagatacggcctgtgtgtgtgtgctcagcaggaaggctgtgagaaga
gcctga

DBGET integrated database retrieval system