KEGG   Homo sapiens (human): 4842Help
Entry
4842              CDS       T01001                                 

Gene name
NOS1, IHPS1, N-NOS, NC-NOS, NOS, bNOS, nNOS
Definition
nitric oxide synthase 1 (neuronal) (EC:1.14.13.39)
Orthology
K13240  
nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Calcium signaling pathway
Phagosome
Circadian entrainment
Long-term depression
Salivary secretion
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    4842 (NOS1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    4842 (NOS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    4842 (NOS1)
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    4842 (NOS1)
  Nervous system
   04730 Long-term depression
    4842 (NOS1)
  Environmental adaptation
   04713 Circadian entrainment
    4842 (NOS1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4842 (NOS1)
   05014 Amyotrophic lateral sclerosis (ALS)
    4842 (NOS1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH dependent)
     4842 (NOS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12q24.22
AA seq 1434 aa AA seqDB search
MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP
RPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQV
DRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPS
KCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVRTKGQLF
PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRC
VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVW
NSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQ
IPPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV
RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT
ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHV
WKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCE
IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQ
EERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF
GHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN
SLISNDRSWKRNKFRLTFVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFV
RLHTNGSQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGV
ISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEY
EEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIV
SYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP
FRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSRE
PDKPKKYVQDILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAE
DAGVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS
NT seq 4305 nt NT seq  +upstreamnt  +downstreamnt
atggaggatcacatgttcggtgttcagcaaatccagcccaatgtcatttctgttcgtctc
ttcaagcgcaaagttgggggcctgggatttctggtgaaggagcgggtcagtaagccgccc
gtgatcatctctgacctgattcgtgggggcgccgcagagcagagtggcctcatccaggcc
ggagacatcattcttgcggtcaacggccggcccttggtggacctgagctatgacagcgcc
ctggaggtactcagaggcattgcctctgagacccacgtggtcctcattctgaggggccct
gaaggtttcaccacgcacctggagaccacctttacaggtgatgggacccccaagaccatc
cgggtgacacagcccctgggtccccccaccaaagccgtggatctgtcccaccagccaccg
gccggcaaagaacagcccctggcagtggatggggcctcgggtcccgggaatgggcctcag
catgcctacgatgatgggcaggaggctggctcactcccccatgccaacggcctggccccc
aggcccccaggccaggaccccgcgaagaaagcaaccagagtcagcctccaaggcagaggg
gagaacaatgaactgctcaaggagatagagcctgtgctgagccttctcaccagtgggagc
agaggggtcaagggaggggcacctgccaaggcagagatgaaagatatgggaatccaggtg
gacagagatttggacggcaagtcacacaaacctctgcccctcggcgtggagaacgaccga
gtcttcaatgacctatgggggaagggcaatgtgcctgtcgtcctcaacaacccatattca
gagaaggagcagccccccacctcaggaaaacagtcccccacaaagaatggcagcccctcc
aagtgtccacgcttcctcaaggtcaagaactgggagactgaggtggttctcactgacacc
ctccaccttaagagcacattggaaacgggatgcactgagtacatctgcatgggctccatc
atgcatccttctcagcatgcaaggaggcctgaagacgtccgcacaaaaggacagctcttc
cctctcgccaaagagtttattgatcaatactattcatcaattaaaagatttggctccaaa
gcccacatggaaaggctggaagaggtgaacaaagagatcgacaccactagcacttaccag
ctcaaggacacagagctcatctatggggccaagcacgcctggcggaatgcctcgcgctgt
gtgggcaggatccagtggtccaagctgcaggtattcgatgcccgtgactgcaccacggcc
cacgggatgttcaactacatctgtaaccatgtcaagtatgccaccaacaaagggaacctc
aggtctgccatcaccatattcccccagaggacagacggcaagcacgacttccgagtctgg
aactcccagctcatccgctacgctggctacaagcagcctgacggctccaccctgggggac
ccagccaatgtgcagttcacagagatatgcatacagcagggctggaaaccgcctagaggc
cgcttcgatgtcctgccgctcctgcttcaggccaacggcaatgaccctgagctcttccag
attcctccagagctggtgttggaagttcccatcaggcaccccaagtttgagtggttcaag
gacctggggctgaagtggtacggcctccccgccgtgtccaacatgctcctagagattggc
ggcctggagttcagcgcctgtcccttcagtggctggtacatgggcacagagattggtgtc
cgcgactactgtgacaactcccgctacaatatcctggaggaagtggccaagaagatgaac
ttagacatgaggaagacgtcctccctgtggaaggaccaggcgctggtggagatcaatatc
gcggttctctatagcttccagagtgacaaagtgaccattgttgaccatcactccgccacc
gagtccttcattaagcacatggagaatgagtaccgctgccgggggggctgccctgccgac
tgggtgtggatcgtgccccccatgtccggaagcatcacccctgtgttccaccaggagatg
ctcaactaccggctcaccccctccttcgaataccagcctgatccctggaacacgcatgtc
tggaaaggcaccaacgggacccccacaaagcggcgagccattggcttcaagaagctagca
gaagctgtcaagttctcggccaagctgatggggcaggctatggccaagagggtgaaagcg
accatcctctatgccacagagacaggcaaatcgcaagcttatgccaagaccttgtgtgag
atcttcaaacacgcctttgatgccaaggtgatgtccatggaagaatatgacattgtgcac
ctggaacatgaaactctggtccttgtggtcaccagcacctttggcaatggagatccccct
gagaatggggagaaattcggctgtgctttgatggaaatgaggcaccccaactctgtgcag
gaagaaaggaagagctacaaggtccgattcaacagcgtctcctcctactctgactcccaa
aaatcatcaggcgatgggcccgacctcagagacaactttgagagtgctggacccctggcc
aatgtgaggttctcagtttttggcctcggctcacgagcataccctcacttttgcgccttc
ggacacgctgtggacaccctcctggaagaactgggaggggagaggatcctgaagatgagg
gaaggggatgagctctgtgggcaggaagaggctttcaggacctgggccaagaaggtcttc
aaggcagcctgtgatgtcttctgtgtgggagatgatgtcaacattgaaaaggccaacaat
tccctcatcagcaatgatcgcagctggaagagaaacaagttccgcctcacctttgtggcc
gaagctccagaactcacacaaggtctatccaatgtccacaaaaagcgagtctcagctgcc
cggctccttagccgtcaaaacctccagagccctaaatccagtcggtcaactatcttcgtg
cgtctccacaccaacgggagccaggagctgcagtaccagcctggggaccacctgggtgtc
ttccctggcaaccacgaggacctcgtgaatgccctgatcgagcggctggaggacgcgccg
cctgtcaaccagatggtgaaagtggaactgctggaggagcggaacacggctttaggtgtc
atcagtaactggacagacgagctccgcctcccgccctgcaccatcttccaggccttcaag
tactacctggacatcaccacgccaccaacgcctctgcagctgcagcagtttgcctcccta
gctaccagcgagaaggagaagcagcgtctgctggtcctcagcaagggtttgcaggagtac
gaggaatggaaatggggcaagaaccccaccatcgtggaggtgctggaggagttcccatct
atccagatgccggccaccctgctcctgacccagctgtccctgctgcagccccgctactat
tccatcagctcctccccagacatgtaccctgatgaagtgcacctcactgtggccatcgtt
tcctaccgcactcgagatggagaaggaccaattcaccacggcgtatgctcctcctggctc
aaccggatacaggctgacgaactggtcccctgtttcgtgagaggagcacccagcttccac
ctgccccggaacccccaagtcccctgcatcctcgttggaccaggcaccggcattgcccct
ttccgaagcttctggcaacagcggcaatttgatatccaacacaaaggaatgaacccctgc
cccatggtcctggtcttcgggtgccggcaatccaagatagatcatatctacagggaagag
accctgcaggccaagaacaagggggtcttcagagagctgtacacggcttactcccgggag
ccagacaaaccaaagaagtacgtgcaggacatcctgcaggagcagctggcggagtctgtg
taccgagccctgaaggagcaagggggccacatatacgtctgtggggacgtcaccatggct
gctgatgtcctcaaagccatccagcgcatcatgacccagcaggggaagctctcggcagag
gacgccggcgtattcatcagccggatgagggatgacaaccgataccatgaggatattttt
ggagtcaccctgcgaacgtacgaagtgaccaaccgccttagatctgagtccattgccttc
attgaagagagcaaaaaagacaccgatgaggttttcagctcctaa

DBGET integrated database retrieval system