KEGG   Homo sapiens (human): 4914Help
Entry
4914              CDS       T01001                                 

Gene name
NTRK1, MTC, TRK, TRK1, TRKA, Trk-A, p140-TrkA
Definition
neurotrophic tyrosine kinase, receptor, type 1 (EC:2.7.10.1)
Orthology
K03176  
neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Endocytosis
Apoptosis
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Disease
H00032  
Thyroid cancer
H00043  
Neuroblastoma
H00265  
Hereditary sensory and autonomic neuropathy (HSAN)
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Thyroid cancer [PATH:hsa05216]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1q21-q22
AA seq 760 aa AA seqDB search
MKEAALICLAPSVPPILTVKSWDTMQLRAARSRCTNLLAASYIENQQHLQHLELRDLRGL
GELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPL
HCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDD
VLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAEND
VGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFT
EFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDP
IPDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVL
APEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWEL
GEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFF
GVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAA
GMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPP
ESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEV
YAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaggccgccctcatctgcctggcaccctctgtacccccgatcttgacggtgaag
tcctgggacaccatgcagttgcgggctgctagatctcggtgcacaaacttgttggcagca
agctacatcgagaaccagcagcatctgcagcatctggagctccgtgatctgaggggcctg
ggggagctgagaaacctcaccatcgtgaagagtggtctccgtttcgtggcgccagatgcc
ttccatttcactcctcggctcagtcgcctgaatctctccttcaacgctctggagtctctc
tcctggaaaactgtgcagggcctctccttacaggaactggtcctgtcggggaaccctctg
cactgttcttgtgccctgcgctggctacagcgctgggaggaggagggactgggcggagtg
cctgaacagaagctgcagtgtcatgggcaagggcccctggcccacatgcccaatgccagc
tgtggtgtgcccacgctgaaggtccaggtgcccaatgcctcggtggatgtgggggacgac
gtgctgctgcggtgccaggtggaggggcggggcctggagcaggccggctggatcctcaca
gagctggagcagtcagccacggtgatgaaatctgggggtctgccatccctggggctgacc
ctggccaatgtcaccagtgacctcaacaggaagaacgtgacgtgctgggcagagaacgat
gtgggccgggcagaggtctctgttcaggtcaacgtctccttcccggccagtgtgcagctg
cacacggcggtggagatgcaccactggtgcatccccttctctgtggatgggcagccggca
ccgtctctgcgctggctcttcaatggctccgtgctcaatgagaccagcttcatcttcact
gagttcctggagccggcagccaatgagaccgtgcggcacgggtgtctgcgcctcaaccag
cccacccacgtcaacaacggcaactacacgctgctggctgccaaccccttcggccaggcc
tccgcctccatcatggctgccttcatggacaaccctttcgagttcaaccccgaggacccc
atccctgacactaacagcacatctggagacccggtggagaagaaggacgaaacacctttt
ggggtctcggtggctgtgggcctggccgtctttgcctgcctcttcctttctacgctgctc
cttgtgctcaacaaatgtggacggagaaacaagtttgggatcaaccgcccggctgtgctg
gctccagaggatgggctggccatgtccctgcatttcatgacattgggtggcagctccctg
tcccccaccgagggcaaaggctctgggctccaaggccacatcatcgagaacccacaatac
ttcagtgatgcctgtgttcaccacatcaagcgccgggacatcgtgctcaagtgggagctg
ggggagggcgcctttgggaaggtcttccttgctgagtgccacaacctcctgcctgagcag
gacaagatgctggtggctgtcaaggcactgaaggaggcgtccgagagtgctcggcaggac
ttccagcgtgaggctgagctgctcaccatgctgcagcaccagcacatcgtgcgcttcttc
ggcgtctgcaccgagggccgccccctgctcatggtctttgagtatatgcggcacggggac
ctcaaccgcttcctccgatcccatggacctgatgccaagctgctggctggtggggaggat
gtggctccaggccccctgggtctggggcagctgctggccgtggctagccaggtcgctgcg
gggatggtgtacctggcgggtctgcattttgtgcaccgggacctggccacacgcaactgt
ctagtgggccagggactggtggtcaagattggtgattttggcatgagcagggatatctac
agcaccgactattaccgtgtgggaggccgcaccatgctgcccattcgctggatgccgccc
gagagcatcctgtaccgtaagttcaccaccgagagcgacgtgtggagcttcggcgtggtg
ctctgggagatcttcacctacggcaagcagccctggtaccagctctccaacacggaggca
atcgactgcatcacgcagggacgtgagttggagcggccacgtgcctgcccaccagaggtc
tacgccatcatgcggggctgctggcagcgggagccccagcaacgccacagcatcaaggat
gtgcacgcccggctgcaagccctggcccaggcacctcctgtctacctggatgtcctgggc
tag

DBGET integrated database retrieval system