KEGG   Homo sapiens (human): 4914Help
Entry
4914              CDS       T01001                                 

Gene name
NTRK1, MTC, TRK, TRK1, TRKA, Trk-A, p140-TrkA
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 1 (EC:2.7.10.1)
  KO
K03176  
neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Endocytosis
Apoptosis
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Central carbon metabolism in cancer
Disease
H00032  
Thyroid cancer
H00043  
Neuroblastoma
H00265  
Hereditary sensory and autonomic neuropathy (HSAN)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4914 (NTRK1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    4914 (NTRK1)
  Cell growth and death
   04210 Apoptosis
    4914 (NTRK1)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    4914 (NTRK1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    4914 (NTRK1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4914 (NTRK1)
   05230 Central carbon metabolism in cancer
    4914 (NTRK1)
   05202 Transcriptional misregulation in cancers
    4914 (NTRK1)
   05216 Thyroid cancer
    4914 (NTRK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4914 (NTRK1)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Trk family [OT]
   4914 (NTRK1)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class VII (TRK receptor family)
   4914 (NTRK1)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class VII (TRK receptor family)
   4914 (NTRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1q21-q22
AA seq 796 aa AA seqDB search
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaggcggacggcgcgggcagcttggctggcacagctgggctgcggggccgggc
agcctgctggcttggctgatactggcatctgcgggcgccgcaccctgccccgatgcctgc
tgcccccacggctcctcgggactgcgatgcacccgggatggggccctggatagcctccac
cacctgcccggcgcagagaacctgactgagctctacatcgagaaccagcagcatctgcag
catctggagctccgtgatctgaggggcctgggggagctgagaaacctcaccatcgtgaag
agtggtctccgtttcgtggcgccagatgccttccatttcactcctcggctcagtcgcctg
aatctctccttcaacgctctggagtctctctcctggaaaactgtgcagggcctctcctta
caggaactggtcctgtcggggaaccctctgcactgttcttgtgccctgcgctggctacag
cgctgggaggaggagggactgggcggagtgcctgaacagaagctgcagtgtcatgggcaa
gggcccctggcccacatgcccaatgccagctgtggtgtgcccacgctgaaggtccaggtg
cccaatgcctcggtggatgtgggggacgacgtgctgctgcggtgccaggtggaggggcgg
ggcctggagcaggccggctggatcctcacagagctggagcagtcagccacggtgatgaaa
tctgggggtctgccatccctggggctgaccctggccaatgtcaccagtgacctcaacagg
aagaacgtgacgtgctgggcagagaacgatgtgggccgggcagaggtctctgttcaggtc
aacgtctccttcccggccagtgtgcagctgcacacggcggtggagatgcaccactggtgc
atccccttctctgtggatgggcagccggcaccgtctctgcgctggctcttcaatggctcc
gtgctcaatgagaccagcttcatcttcactgagttcctggagccggcagccaatgagacc
gtgcggcacgggtgtctgcgcctcaaccagcccacccacgtcaacaacggcaactacacg
ctgctggctgccaaccccttcggccaggcctccgcctccatcatggctgccttcatggac
aaccctttcgagttcaaccccgaggaccccatccctgtctccttctcgccggtggacact
aacagcacatctggagacccggtggagaagaaggacgaaacaccttttggggtctcggtg
gctgtgggcctggccgtctttgcctgcctcttcctttctacgctgctccttgtgctcaac
aaatgtggacggagaaacaagtttgggatcaaccgcccggctgtgctggctccagaggat
gggctggccatgtccctgcatttcatgacattgggtggcagctccctgtcccccaccgag
ggcaaaggctctgggctccaaggccacatcatcgagaacccacaatacttcagtgatgcc
tgtgttcaccacatcaagcgccgggacatcgtgctcaagtgggagctgggggagggcgcc
tttgggaaggtcttccttgctgagtgccacaacctcctgcctgagcaggacaagatgctg
gtggctgtcaaggcactgaaggaggcgtccgagagtgctcggcaggacttccagcgtgag
gctgagctgctcaccatgctgcagcaccagcacatcgtgcgcttcttcggcgtctgcacc
gagggccgccccctgctcatggtctttgagtatatgcggcacggggacctcaaccgcttc
ctccgatcccatggacctgatgccaagctgctggctggtggggaggatgtggctccaggc
cccctgggtctggggcagctgctggccgtggctagccaggtcgctgcggggatggtgtac
ctggcgggtctgcattttgtgcaccgggacctggccacacgcaactgtctagtgggccag
ggactggtggtcaagattggtgattttggcatgagcagggatatctacagcaccgactat
taccgtgtgggaggccgcaccatgctgcccattcgctggatgccgcccgagagcatcctg
taccgtaagttcaccaccgagagcgacgtgtggagcttcggcgtggtgctctgggagatc
ttcacctacggcaagcagccctggtaccagctctccaacacggaggcaatcgactgcatc
acgcagggacgtgagttggagcggccacgtgcctgcccaccagaggtctacgccatcatg
cggggctgctggcagcgggagccccagcaacgccacagcatcaaggatgtgcacgcccgg
ctgcaagccctggcccaggcacctcctgtctacctggatgtcctgggctag

DBGET integrated database retrieval system