KEGG   Homo sapiens (human): 5009Help
Entry
5009              CDS       T01001                                 

Gene name
OTC, OCTD
Definition
ornithine carbamoyltransferase (EC:2.1.3.3)
Orthology
K00611  
ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Disease
H00187  
Ornithine transcarbamylase deficiency
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
Xp21.1
AA seq 354 aa AA seqDB search
MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLS
ADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGV
NESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQ
EHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKEN
GTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTF
LHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttaatctgaggatcctgttaaacaatgcagcttttagaaatggtcacaacttc
atggttcgaaattttcggtgtggacaaccactacaaaataaagtgcagctgaagggccgt
gaccttctcactctaaaaaactttaccggagaagaaattaaatatatgctatggctatca
gcagatctgaaatttaggataaaacagaaaggagagtatttgcctttattgcaagggaag
tccttaggcatgatttttgagaaaagaagtactcgaacaagattgtctacagaaacaggc
tttgcacttctgggaggacatccttgttttcttaccacacaagatattcatttgggtgtg
aatgaaagtctcacggacacggcccgtgtattgtctagcatggcagatgcagtattggct
cgagtgtataaacaatcagatttggacaccctggctaaagaagcatccatcccaattatc
aatgggctgtcagatttgtaccatcctatccagatcctggctgattacctcacgctccag
gaacactatagctctctgaaaggtcttaccctcagctggatcggggatgggaacaatatc
ctgcactccatcatgatgagcgcagcgaaattcggaatgcaccttcaggcagctactcca
aagggttatgagccggatgctagtgtaaccaagttggcagagcagtatgccaaagagaat
ggtaccaagctgttgctgacaaatgatccattggaagcagcgcatggaggcaatgtatta
attacagacacttggataagcatgggacaagaagaggagaagaaaaagcggctccaggct
ttccaaggttaccaggttacaatgaagactgctaaagttgctgcctctgactggacattt
ttacactgcttgcccagaaagccagaagaagtggatgatgaagtcttttattctcctcga
tcactagtgttcccagaggcagaaaacagaaagtggacaatcatggctgtcatggtgtcc
ctgctgacagattactcacctcagctccagaagcctaaattttga

DBGET integrated database retrieval system