KEGG   Homo sapiens (human): 5019Help
Entry
5019              CDS       T01001                                 

Gene name
OXCT1, OXCT, SCOT
Definition
3-oxoacid CoA transferase 1 (EC:2.8.3.5)
Orthology
K01027  
3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Disease
H01121  
Succinyl CoA:3-oxoacid CoA transferase (SCOT) deficiency
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hsa00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:hsa00072]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5p13.1
AA seq 520 aa AA seqDB search
MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVL
VGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENA
EFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSV
AIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAET
TVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDD
VRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEAD
ADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV
KGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDK
KKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIAN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctcaaactcctctcctccgggcttcggctctgcgcctctgcccgcggatct
ggggcaacctggtacaagggatgtgtttgttccttttccaccagtgctcatcgccatacc
aagttttatacagatccagtagaagctgtaaaagacatccctgatggtgccacggttttg
gttggtggttttgggctatgtggaattccagagaatcttatagatgctttactgaaaact
ggagtaaaaggactaactgcagtcagcaacaatgcaggggttgacaattttggtttgggg
cttttgcttcggtccaagcagataaaacgcatggtctcttcatatgtgggagaaaatgca
gaatttgaacgacagtacttatctggtgaattagaagtggagctgacaccacagggcaca
cttgcagagaggatccgtgcaggcggggctggagttcctgcattttacaccccaacaggg
tatgggaccctggtacaagaaggaggatcgcccatcaaatacaacaaagatggcagtgtt
gccattgccagtaagccaagagaggtgagggagttcaatggtcagcactttattttggag
gaagcaattacaggggattttgctttggtgaaagcctggaaggcggaccgagcaggaaac
gtgattttcaggaaaagtgcaaggaatttcaacttgccaatgtgcaaagctgcagaaacc
acagtggtagaggttgaagaaattgtggatattggagcatttgctccagaagacatccat
attcctcagatttatgtacatcgccttataaagggagaaaaatatgagaaaagaattgag
cgtttatcaatccggaaagagggagatggggaagccaaatctgctaaacctggagatgac
gtaagggaacgaatcatcaagagggccgctcttgagtttgaggatggcatgtatgctaat
ttgggcataggaatccctctcctggccagcaattttatcagcccaaatataactgttcat
cttcaaagtgaaaatggagttctgggtttgggtccatatccacgacaacatgaagctgat
gcagatctcatcaatgcaggcaaggaaacagttactattcttccaggagcctcttttttc
tccagcgatgaatcatttgcaatgattagaggtggacacgtcgatctgacaatgctagga
gcgatgcaggtttccaaatatggtgacctggctaactggatgatacctgggaagatggtg
aaaggaatgggaggtgctatggatttagtgtccagtgcgaaaaccaaagtggtggtcacc
atggagcattctgcaaagggaaatgcacataaaatcatggagaaatgtacattaccattg
actggaaagcaatgtgtcaaccgcattattactgaaaaggctgtgtttgatgtggacaag
aagaaagggttgactctgattgagctctgggaaggcctgacagtggatgacgtacagaag
agtactgggtgtgattttgcagtttcaccaaaactcatgccaatgcagcagatcgcaaat
tga

DBGET integrated database retrieval system