KEGG   Homo sapiens (human): 5019Help
Entry
5019              CDS       T01001                                 

Gene name
OXCT1, OXCT, SCOT
Definition
(RefSeq) 3-oxoacid CoA-transferase 1
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00072  Synthesis and degradation of ketone bodies
hsa00280  Valine, leucine and isoleucine degradation
hsa00650  Butanoate metabolism
Disease
H01121  Succinyl CoA:3-oxoacid CoA transferase (SCOT) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    5019 (OXCT1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    5019 (OXCT1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    5019 (OXCT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     5019 (OXCT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-GeneID: 5019
NCBI-ProteinID: NP_000427
OMIM: 601424
HGNC: 8527
Ensembl: ENSG00000083720
Vega: OTTHUMG00000094783
Pharos: P55809(Tbio)
UniProt: P55809 A0A024R040
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5p13.1
AA seq 520 aa AA seqDB search
MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVL
VGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENA
EFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSV
AIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAET
TVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDD
VRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEAD
ADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV
KGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDK
KKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIAN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctcaaactcctctcctccgggcttcggctctgcgcctctgcccgcggatct
ggggcaacctggtacaagggatgtgtttgttccttttccaccagtgctcatcgccatacc
aagttttatacagatccagtagaagctgtaaaagacatccctgatggtgccacggttttg
gttggtggttttgggctatgtggaattccagagaatcttatagatgctttactgaaaact
ggagtaaaaggactaactgcagtcagcaacaatgcaggggttgacaattttggtttgggg
cttttgcttcggtccaagcagataaaacgcatggtctcttcatatgtgggagaaaatgca
gaatttgaacgacagtacttatctggtgaattagaagtggagctgacaccacagggcaca
cttgcagagaggatccgtgcaggcggggctggagttcctgcattttacaccccaacaggg
tatgggaccctggtacaagaaggaggatcgcccatcaaatacaacaaagatggcagtgtt
gccattgccagtaagccaagagaggtgagggagttcaatggtcagcactttattttggag
gaagcaattacaggggattttgctttggtgaaagcctggaaggcggaccgagcaggaaac
gtgattttcaggaaaagtgcaaggaatttcaacttgccaatgtgcaaagctgcagaaacc
acagtggtagaggttgaagaaattgtggatattggagcatttgctccagaagacatccat
attcctcagatttatgtacatcgccttataaagggagaaaaatatgagaaaagaattgag
cgtttatcaatccggaaagagggagatggggaagccaaatctgctaaacctggagatgac
gtaagggaacgaatcatcaagagggccgctcttgagtttgaggatggcatgtatgctaat
ttgggcataggaatccctctcctggccagcaattttatcagcccaaatataactgttcat
cttcaaagtgaaaatggagttctgggtttgggtccatatccacgacaacatgaagctgat
gcagatctcatcaatgcaggcaaggaaacagttactattcttccaggagcctcttttttc
tccagcgatgaatcatttgcaatgattagaggtggacacgtcgatctgacaatgctagga
gcgatgcaggtttccaaatatggtgacctggctaactggatgatacctgggaagatggtg
aaaggaatgggaggtgctatggatttagtgtccagtgcgaaaaccaaagtggtggtcacc
atggagcattctgcaaagggaaatgcacataaaatcatggagaaatgtacattaccattg
actggaaagcaatgtgtcaaccgcattattactgaaaaggctgtgtttgatgtggacaag
aagaaagggttgactctgattgagctctgggaaggcctgacagtggatgacgtacagaag
agtactgggtgtgattttgcagtttcaccaaaactcatgccaatgcagcagatcgcaaat
tga

DBGET integrated database retrieval system