KEGG   Homo sapiens (human): 5071Help
Entry
5071              CDS       T01001                                 

Gene name
PARK2, AR-JP, LPRS2, PDJ, PRKN
Definition
parkin RBR E3 ubiquitin protein ligase
Orthology
K04556  
parkin [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Parkinson's disease
Disease
H00057  
Parkinson's disease (PD)
H00344  
Leprosy
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
6q25.2-q27
AA seq 465 aa AA seqDB search
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD
LDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLA
VILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGP
SCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCIT
CTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKE
LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGC
GFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPR
CHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgtttgtcaggttcaactccagccatggtttcccagtggaggtcgattctgac
accagcatcttccagctcaaggaggtggttgctaagcgacagggggttccggctgaccag
ttgcgtgtgattttcgcagggaaggagctgaggaatgactggactgtgcagaattgtgac
ctggatcagcagagcattgttcacattgtgcagagaccgtggagaaaaggtcaagaaatg
aatgcaactggaggcgacgaccccagaaacgcggcgggaggctgtgagcgggagccccag
agcttgactcgggtggacctcagcagctcagtcctcccaggagactctgtggggctggct
gtcattctgcacactgacagcaggaaggactcaccaccagctggaagtccagcaggtaga
tcaatctacaacagcttttatgtgtattgcaaaggcccctgtcaaagagtgcagccggga
aaactcagggtacagtgcagcacctgcaggcaggcaacgctcaccttgacccagggtcca
tcttgctgggatgatgttttaattccaaaccggatgagtggtgaatgccaatccccacac
tgccctgggactagtgcagaatttttctttaaatgtggagcacaccccacctctgacaag
gaaacatcagtagctttgcacctgatcgcaacaaatagtcggaacatcacttgcattacg
tgcacagacgtcaggagccccgtcctggttttccagtgcaactcccgccacgtgatttgc
ttagactgtttccacttatactgtgtgacaagactcaatgatcggcagtttgttcacgac
cctcaacttggctactccctgccttgtgtggctggctgtcccaactccttgattaaagag
ctccatcacttcaggattctgggagaagagcagtacaaccggtaccagcagtatggtgca
gaggagtgtgtcctgcagatggggggcgtgttatgcccccgccctggctgtggagcgggg
ctgctgccggagcctgaccagaggaaagtcacctgcgaagggggcaatggcctgggctgt
gggtttgccttctgccgggaatgtaaagaagcgtaccatgaaggggagtgcagtgccgta
tttgaagcctcaggaacaactactcaggcctacagagtcgatgaaagagccgccgagcag
gctcgttgggaagcagcctccaaagaaaccatcaagaaaaccaccaagccctgtccccgc
tgccatgtaccagtggaaaaaaatggaggctgcatgcacatgaagtgtccgcagccccag
tgcaggctcgagtggtgctggaactgtggctgcgagtggaaccgcgtctgcatgggggac
cactggttcgacgtgtag

DBGET integrated database retrieval system