KEGG   Homo sapiens (human): 5071Help
Entry
5071              CDS       T01001                                 

Gene name
PRKN, AR-JP, LPRS2, PARK2, PDJ
Definition
(RefSeq) parkin RBR E3 ubiquitin protein ligase
  KO
K04556  parkin [EC:2.3.2.31]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa05012  Parkinson's disease
Disease
H00057  Parkinson's disease (PD)
H00344  Leprosy
H01600  Parkinsonian syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5071 (PRKN)
   04120 Ubiquitin mediated proteolysis
    5071 (PRKN)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    5071 (PRKN)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    5071 (PRKN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     5071 (PRKN)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    5071 (PRKN)
  Aggrephagy
   Other aggrephagy associated proteins
    5071 (PRKN)
  Xenophagy
   Other xenophagy associated proteins
    5071 (PRKN)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    5071 (PRKN)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    5071 (PRKN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin IBR Rad60-SLD Rad60-SLD_2 DUF2407
Motif
Other DBs
NCBI-GeneID: 5071
NCBI-ProteinID: NP_004553
OMIM: 602544
HGNC: 8607
Ensembl: ENSG00000185345
Vega: OTTHUMG00000015970
Pharos: O60260(Tbio)
UniProt: O60260 X5DR79
LinkDB All DBs
Structure
PDB: 

Jmol
Position
6q26
AA seq 465 aa AA seqDB search
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD
LDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLA
VILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGP
SCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCIT
CTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKE
LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGC
GFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPR
CHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgtttgtcaggttcaactccagccatggtttcccagtggaggtcgattctgac
accagcatcttccagctcaaggaggtggttgctaagcgacagggggttccggctgaccag
ttgcgtgtgattttcgcagggaaggagctgaggaatgactggactgtgcagaattgtgac
ctggatcagcagagcattgttcacattgtgcagagaccgtggagaaaaggtcaagaaatg
aatgcaactggaggcgacgaccccagaaacgcggcgggaggctgtgagcgggagccccag
agcttgactcgggtggacctcagcagctcagtcctcccaggagactctgtggggctggct
gtcattctgcacactgacagcaggaaggactcaccaccagctggaagtccagcaggtaga
tcaatctacaacagcttttatgtgtattgcaaaggcccctgtcaaagagtgcagccggga
aaactcagggtacagtgcagcacctgcaggcaggcaacgctcaccttgacccagggtcca
tcttgctgggatgatgttttaattccaaaccggatgagtggtgaatgccaatccccacac
tgccctgggactagtgcagaatttttctttaaatgtggagcacaccccacctctgacaag
gaaacatcagtagctttgcacctgatcgcaacaaatagtcggaacatcacttgcattacg
tgcacagacgtcaggagccccgtcctggttttccagtgcaactcccgccacgtgatttgc
ttagactgtttccacttatactgtgtgacaagactcaatgatcggcagtttgttcacgac
cctcaacttggctactccctgccttgtgtggctggctgtcccaactccttgattaaagag
ctccatcacttcaggattctgggagaagagcagtacaaccggtaccagcagtatggtgca
gaggagtgtgtcctgcagatggggggcgtgttatgcccccgccctggctgtggagcgggg
ctgctgccggagcctgaccagaggaaagtcacctgcgaagggggcaatggcctgggctgt
gggtttgccttctgccgggaatgtaaagaagcgtaccatgaaggggagtgcagtgccgta
tttgaagcctcaggaacaactactcaggcctacagagtcgatgaaagagccgccgagcag
gctcgttgggaagcagcctccaaagaaaccatcaagaaaaccaccaagccctgtccccgc
tgccatgtaccagtggaaaaaaatggaggctgcatgcacatgaagtgtccgcagccccag
tgcaggctcgagtggtgctggaactgtggctgcgagtggaaccgcgtctgcatgggggac
cactggttcgacgtgtag

DBGET integrated database retrieval system