KEGG   Homo sapiens (human): 5071Help
Entry
5071              CDS       T01001                                 

Gene name
PARK2, AR-JP, LPRS2, PDJ, PRKN
Definition
parkin RBR E3 ubiquitin protein ligase
Orthology
K04556  
parkin [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Parkinson's disease
Disease
H00057  
Parkinson's disease (PD)
H00344  
Leprosy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5071 (PARK2)
   04120 Ubiquitin mediated proteolysis
    5071 (PARK2)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    5071 (PARK2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     5071 (PARK2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    5071 (PARK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
6q25.2-q27
AA seq 465 aa AA seqDB search
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD
LDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLA
VILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGP
SCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCIT
CTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKE
LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGC
GFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPR
CHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgtttgtcaggttcaactccagccatggtttcccagtggaggtcgattctgac
accagcatcttccagctcaaggaggtggttgctaagcgacagggggttccggctgaccag
ttgcgtgtgattttcgcagggaaggagctgaggaatgactggactgtgcagaattgtgac
ctggatcagcagagcattgttcacattgtgcagagaccgtggagaaaaggtcaagaaatg
aatgcaactggaggcgacgaccccagaaacgcggcgggaggctgtgagcgggagccccag
agcttgactcgggtggacctcagcagctcagtcctcccaggagactctgtggggctggct
gtcattctgcacactgacagcaggaaggactcaccaccagctggaagtccagcaggtaga
tcaatctacaacagcttttatgtgtattgcaaaggcccctgtcaaagagtgcagccggga
aaactcagggtacagtgcagcacctgcaggcaggcaacgctcaccttgacccagggtcca
tcttgctgggatgatgttttaattccaaaccggatgagtggtgaatgccaatccccacac
tgccctgggactagtgcagaatttttctttaaatgtggagcacaccccacctctgacaag
gaaacatcagtagctttgcacctgatcgcaacaaatagtcggaacatcacttgcattacg
tgcacagacgtcaggagccccgtcctggttttccagtgcaactcccgccacgtgatttgc
ttagactgtttccacttatactgtgtgacaagactcaatgatcggcagtttgttcacgac
cctcaacttggctactccctgccttgtgtggctggctgtcccaactccttgattaaagag
ctccatcacttcaggattctgggagaagagcagtacaaccggtaccagcagtatggtgca
gaggagtgtgtcctgcagatggggggcgtgttatgcccccgccctggctgtggagcgggg
ctgctgccggagcctgaccagaggaaagtcacctgcgaagggggcaatggcctgggctgt
gggtttgccttctgccgggaatgtaaagaagcgtaccatgaaggggagtgcagtgccgta
tttgaagcctcaggaacaactactcaggcctacagagtcgatgaaagagccgccgagcag
gctcgttgggaagcagcctccaaagaaaccatcaagaaaaccaccaagccctgtccccgc
tgccatgtaccagtggaaaaaaatggaggctgcatgcacatgaagtgtccgcagccccag
tgcaggctcgagtggtgctggaactgtggctgcgagtggaaccgcgtctgcatgggggac
cactggttcgacgtgtag

DBGET integrated database retrieval system