KEGG   Homo sapiens (human): 51082Help
Entry
51082             CDS       T01001                                 

Gene name
POLR1D, AC19, POLR1C, RPA16, RPA9, RPAC2, RPC16, RPO1-3, TCS2
Definition
(RefSeq) RNA polymerase I and III subunit D
  KO
K03020  DNA-directed RNA polymerases I and III subunit RPAC2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05169  Epstein-Barr virus infection
Module
hsa_M00181  RNA polymerase III, eukaryotes
hsa_M00182  RNA polymerase I, eukaryotes
Disease
H00610  Treacher Collins syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    51082 (POLR1D)
   00240 Pyrimidine metabolism
    51082 (POLR1D)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    51082 (POLR1D)
 Organismal Systems
  Immune system
   04623 Cytosolic DNA-sensing pathway
    51082 (POLR1D)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    51082 (POLR1D)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     51082 (POLR1D)
  RNA polymerase I system
   RNA polymerase I
     51082 (POLR1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Motif
Other DBs
NCBI-GeneID: 51082
NCBI-ProteinID: NP_057056
OMIM: 613715
HGNC: 20422
Ensembl: ENSG00000186184
Vega: OTTHUMG00000016635
Pharos: Q9Y2S0(Tbio)
UniProt: P0DPB6
LinkDB All DBs
Position
13q12.2
AA seq 133 aa AA seqDB search
MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIM
KNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKD
YKDQKASRNESTF
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggatcaggagctggagagaaaaatatctggattgaagacctcaatggctgaa
ggcgagaggaagacagccctggaaatggtccaggcagctggaacagatagacactgtgtg
acatttgtattgcacgaggaagaccataccctaggaaattctctacgttacatgatcatg
aagaacccggaagtggaattttgtggttacactacgacccatccttcagagagcaaaatt
aatttacgcattcagactcgaggtacccttccagctgttgagccatttcagagaggcctg
aatgagctcatgaatgtctgccaacatgtgcttgacaagtttgaggccagcataaaggac
tataaggatcaaaaagcaagcagaaatgaatccacattctag

DBGET integrated database retrieval system