KEGG   Homo sapiens (human): 51135Help
Entry
51135             CDS       T01001                                 

Gene name
IRAK4, IPD1, IRAK-4, NY-REN-64, REN64
Definition
interleukin-1 receptor-associated kinase 4 (EC:2.7.11.1)
Orthology
K04733  
interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
Toll-like receptor signaling pathway
Neurotrophin signaling pathway
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Measles
Influenza A
Disease
H00096  
Defects of toll-like receptor signaling
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
12q12
AA seq 460 aa AA seqDB search
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacccataacaccatcaacatatgtgcgctgcctcaatgttggactaattagg
aagctgtcagattttattgatcctcaagaaggatggaagaagttagctgtagctattaaa
aaaccatctggtgatgatagatacaatcagtttcacataaggagatttgaagcattactt
caaactggaaaaagtcccacttctgaattactgtttgactggggcaccacaaattgcaca
gttggtgatcttgtggatcttttgatccaaaatgaattttttgctcctgcgagtcttttg
ctcccagatgctgttcccaaaactgctaatacactaccttctaaagaagctataacagtt
cagcaaaaacagatgcctttctgtgacaaagacaggacattgatgacacctgtgcagaat
cttgaacaaagctatatgccacctgactcctcaagtccagaaaataaaagtttagaagtt
agtgatacacgttttcacagtttttcattttatgaattgaagaatgtcacaaataacttt
gatgaacgacccatttctgttggtggtaataaaatgggagagggaggatttggagttgta
tataaaggctacgtaaataacacaactgtggcagtgaagaagcttgcagcaatggttgac
attactactgaagaactgaaacagcagtttgatcaagaaataaaagtaatggcaaagtgt
caacatgaaaacttagtagaactacttggtttctcaagtgatggagatgacctctgctta
gtatatgtttacatgcctaatggttcattgctagacagactctcttgcttggatggtact
ccaccactttcttggcacatgagatgcaagattgctcagggtgcagctaatggcatcaat
tttctacatgaaaatcatcatattcatagagatattaaaagtgcaaatatcttactggat
gaagcttttactgctaaaatatctgactttggccttgcacgggcttctgagaagtttgcc
cagacagtcatgactagcagaattgtgggaacaacagcttatatggcaccagaagctttg
cgtggagaaataacacccaaatctgatatttacagctttggtgtggttttactagaaata
ataactggacttccagctgtggatgaacaccgtgaacctcagttattgctagatattaaa
gaagaaattgaagatgaagaaaagacaattgaagattatattgataaaaagatgaatgat
gctgattccacttcagttgaagctatgtactctgttgctagtcaatgtctgcatgaaaag
aaaaataagagaccagacattaagaaggttcaacagctgctgcaagagatgacagcttct
taa

DBGET integrated database retrieval system