KEGG   Homo sapiens (human): 5122Help
Entry
5122              CDS       T01001                                 

Gene name
PCSK1, BMIQ12, NEC1, PC1, PC3, SPC3
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     5122 (PCSK1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S8: subtilisin family
   5122 (PCSK1)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Subtilisin family
   5122 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain OmpA_membrane Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 5122
NCBI-ProteinID: NP_000430
OMIM: 162150
HGNC: 8743
Ensembl: ENSG00000175426
Vega: OTTHUMG00000122089
Pharos: P29120(Tchem)
UniProt: P29120
LinkDB All DBs
Position
5q15
AA seq 753 aa AA seqDB search
MERRAWSLQCTAFVLFCAWCALNSAKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSALRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALK
ANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENPKENTLVSKSPSSSSVGGRRDELEE
GAPSQAMLRLLQSAFSKNSPPKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSL
YNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaagagcctggagtctgcagtgcactgctttcgtcctcttttgcgcttggtgt
gcactgaacagtgcaaaagcgaaaaggcaatttgtcaatgaatgggcagcggagatcccc
gggggcccggaagcagcctcggccatcgccgaggagctgggctatgaccttttgggtcag
attggttcacttgaaaatcactacttattcaaacataaaaaccaccccagaaggtctcga
aggagtgcctttcatatcactaagagattatctgatgatgatcgtgtgatatgggctgaa
caacagtatgaaaaagaaagaagtaaacgttcagctctaagggactcagcactaaatctc
ttcaatgatcccatgtggaatcagcaatggtacttgcaagataccaggatgacggcagcc
ctgcccaagctggaccttcatgtgatacctgtttggcaaaaaggcattacgggcaaagga
gttgttatcaccgtactggatgatggtttggagtggaatcacacggacatttatgccaac
tatgatccagaggctagctatgattttaatgataatgaccatgatccatttccccgatat
gatcccacaaacgagaacaaacacgggaccagatgtgcaggagaaattgccatgcaagca
aataatcacaaatgcggggttggagttgcatacaattccaaagttggaggcataagaatg
ctggatggcattgtgacggatgctattgaggccagttcaattggattcaatcctggacac
gtggatatttacagtgcaagctggggccctaatgatgatgggaaaactgtggaggggcct
ggccggctagcccagaaggcttttgaatatggtgtcaaacaggggagacaggggaagggg
tccatcttcgtctgggcttcgggaaacggggggcgtcagggagataattgtgactgtgat
ggctacacagacagcatctacaccatctccatcagcagtgcctcccagcaaggcctatcc
ccctggtacgctgagaagtgctcctccacactggccacctcttacagcagcggagattac
accgaccagagaatcacgagcgctgacctgcacaatgactgcacggagacgcacacaggc
acctcggcctctgcacctctggctgctggcatcttcgctctggccctggaagcaaaccca
aatctcacctggcgagatatgcagcacctggttgtctggacctctgagtatgacccgctg
gccaataaccctggatggaaaaagaatggagcaggcttgatggtgaatagtcgatttgga
tttggcttgctaaatgccaaagctctggtggatttagctgaccccaggacctggaggagc
gtgcctgagaagaaagagtgtgttgtaaaggacaatgactttgagcccagagccctgaaa
gctaatggagaagttatcattgaaattccaacaagagcttgtgaaggacaagaaaatgct
atcaagtccctggagcatgtacaatttgaagcaacaattgaatattcccgaagaggagac
cttcatgtcacacttacttctgctgctggaactagcactgtgctcttggctgaaagagaa
cgggatacatctcctaatggctttaagaattgggacttcatgtctgttcacacatgggga
gagaaccctataggtacttggactttgagaattacagacatgtctggaagaattcaaaat
gaaggaagaattgtgaactggaagctgattttgcacgggacctcttctcagccagagcat
atgaagcagcctcgtgtgtacacgtcctacaacactgttcagaatgacagaagaggggtg
gagaagatggtggatccaggggaggagcagcccacacaagagaaccctaaggagaacacc
ctggtgtccaaaagccccagcagcagcagcgtagggggccggagggatgagttggaggag
ggagccccttcccaggccatgctgcgactcctgcaaagtgctttcagtaaaaactcaccg
ccaaagcaatcaccaaagaagtccccaagtgcaaagctcaacatcccttatgaaaacttc
tacgaagccctggaaaagctgaacaaaccttcccagcttaaagactctgaagacagtctg
tataatgactatgttgatgttttttataacactaaaccttacaagcacagagacgaccgg
ctgcttcaagctctggtggacattctgaatgaggaaaattaa

DBGET integrated database retrieval system