KEGG   Homo sapiens (human): 51422Help
Entry
51422             CDS       T01001                                 

Gene name
PRKAG2, AAKG, AAKG2, CMH6, H91620p, WPWS
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 2
  KO
K07200  
5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Disease
H00069  
Glycogen storage diseases (GSD)
H00292  
Hypertrophic cardiomyopathy (HCM)
H01154  
Wolff-Parkinson-White (WPW) syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    51422 (PRKAG2)
   04152 AMPK signaling pathway
    51422 (PRKAG2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    51422 (PRKAG2)
   04922 Glucagon signaling pathway
    51422 (PRKAG2)
   04920 Adipocytokine signaling pathway
    51422 (PRKAG2)
   04921 Oxytocin signaling pathway
    51422 (PRKAG2)
  Aging
   04211 Longevity regulating pathway - mammal
    51422 (PRKAG2)
   04213 Longevity regulating pathway - multiple species
    51422 (PRKAG2)
  Environmental adaptation
   04710 Circadian rhythm
    51422 (PRKAG2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    51422 (PRKAG2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    51422 (PRKAG2)
   04931 Insulin resistance
    51422 (PRKAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
7q36.1
AA seq 569 aa AA seqDB search
MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSS
RKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRR
MSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEA
GMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANG
VRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKP
LVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAF
MKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVIN
LAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADS
IVGIISLSDILQALILTPAGAKQKETETE
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgcggttatggacaccaagaagaaaaaagatgtttccagccccggcgggagc
ggcggcaagaaaaatgccagccagaagaggcgttcgctgcgcgtgcacattccggacctg
agctccttcgccatgccgctcctggacggagacctggagggttccggaaagcattcctct
cgaaaggtggacagccccttcggcccgggcagcccctccaaagggttcttctccagaggc
ccccagccccggccctccagccccatgtctgcacctgtgaggcccaagaccagccccggc
tctcccaaaaccgtgttcccgttctcctaccaggagtccccgccacgctcccctcgacgc
atgagcttcagtgggatcttccgctcctcctccaaagagtcttcccccaactccaaccct
gctacctcgcccgggggcatcaggtttttctcccgctccagaaaaacctccggcctctcc
tcctctccgtcaacacccacccaagtgaccaagcagcacacgtttcccctggaatcctat
aagcacgagcctgaacggttagagaatcgcatctatgcctcgtcttcccccccggacaca
gggcagaggttctgcccgtcttccttccagagcccgaccaggcctccactggcatcaccg
acacactatgctccctccaaagccgcggcgctggcggcggccctgggacccgcggaagcc
ggcatgctggagaagctggagttcgaggacgaagcagtagaagactcagaaagtggtgtt
tacatgcgattcatgaggtcacacaagtgttatgacatcgttccaaccagttcaaagctt
gttgtctttgatactacattacaagttaaaaaggccttctttgctttggtagccaacggt
gtccgagcagcgccactgtgggagagtaaaaaacaaagttttgtaggaatgctaacaatt
acagatttcataaatatactacatagatactataaatcacctatggtacagatttatgaa
ttagaggaacataaaattgaaacatggagggagctttatttacaagaaacatttaagcct
ttagtgaatatatctccagatgcaagcctcttcgatgctgtatactccttgatcaaaaat
aaaatccacagattgcccgttattgaccctatcagtgggaatgcactttatatacttacc
cacaaaagaatcctcaagttcctccagctttttatgtctgatatgccaaagcctgccttc
atgaagcagaacctggatgagcttggaataggaacgtaccacaacattgccttcatacat
ccagacactcccatcatcaaagccttgaacatatttgtggaaagacgaatatcagctctg
cctgttgtggatgagtcaggaaaagttgtagatatttattccaaatttgatgtaattaat
cttgctgctgagaaaacatacaataacctagatatcacggtgacccaggcccttcagcac
cgttcacagtattttgaaggtgttgtgaagtgcaataagctggaaatactggagaccatc
gtggacagaatagtaagagctgaggtccatcggctggtggtggtaaatgaagcagatagt
attgtgggtattatttccctgtcggacattctgcaagccctgatcctcacaccagcaggt
gccaaacaaaaggagacagaaacggagtga

DBGET integrated database retrieval system