KEGG   Homo sapiens (human): 5160Help
Entry
5160              CDS       T01001                                 

Gene name
PDHA1, PDHA, PDHCE1A, PHE1A
Definition
pyruvate dehydrogenase (lipoamide) alpha 1 (EC:1.2.4.1)
Orthology
K00161  
pyruvate dehydrogenase E1 component subunit alpha [EC:1.2.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Disease
H00072  
Pyruvate dehydrogenase complex deficiency
H01354  
Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5160 (PDHA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5160 (PDHA1)
   00020 Citrate cycle (TCA cycle)
    5160 (PDHA1)
   00620 Pyruvate metabolism
    5160 (PDHA1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    5160 (PDHA1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     5160 (PDHA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
Xp22.1
AA seq 390 aa AA seqDB search
MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTRED
GLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRA
HGFTFTRGLSVREILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALA
CKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAAST
DYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVS
YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPP
LEELGYHIYSSDPPFEVRGANQWIKFKSVS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagatgctcgccgccgtctcccgcgtgctgtctggcgcttctcagaagccggca
agcagagtgctggtagcatcccgtaattttgcaaatgatgctacatttgaaattaagaaa
tgtgaccttcaccggctggaagaaggccctcctgtcacaacagtgctcaccagggaggat
gggctcaaatactacaggatgatgcagactgtacgccgaatggagttgaaagcagatcag
ctgtataaacagaaaattattcgtggtttctgtcacttgtgtgatggtcaggaagcttgc
tgtgtgggcctggaggccggcatcaaccccacagaccatctcatcacagcctaccgggct
cacggctttactttcacccggggcctttccgtccgagaaattctcgcagagcttacagga
cgaaaaggaggttgtgctaaagggaaaggaggatcgatgcacatgtatgccaagaacttc
tacgggggcaatggcatcgtgggagcgcaggtgcccctgggcgctgggattgctctagcc
tgtaagtataatggaaaagatgaggtctgcctgactttatatggcgatggtgctgctaac
cagggccagatattcgaagcttacaacatggcagctttgtggaaattaccttgtattttc
atctgtgagaataatcgctatggaatgggaacgtctgttgagagagcggcagccagcact
gattactacaagagaggcgatttcattcctgggctgagagtggatggaatggatatcctg
tgcgtccgagaggcaacaaggtttgctgctgcctattgtagatctgggaaggggcccatc
ctgatggagctgcagacttaccgttaccacggacacagtatgagtgaccctggagtcagt
taccgtacacgagaagaaattcaggaagtaagaagtaagagtgaccctattatgcttctc
aaggacaggatggtgaacagcaatcttgccagtgtggaagaactaaaggaaattgatgtg
gaagtgaggaaggagattgaggatgctgcccagtttgccacggccgatcctgagccacct
ttggaagagctgggctaccacatctactccagcgacccaccttttgaagttcgtggtgcc
aatcagtggatcaagtttaagtcagtcagttaa

DBGET integrated database retrieval system