KEGG   Homo sapiens (human): 5170Help
Entry
5170              CDS       T01001                                 

Gene name
PDPK1, PDK1, PDPK2, PRO0461
Definition
3-phosphoinositide dependent protein kinase-1 (EC:2.7.11.1)
Orthology
K06276  
3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Neurotrophin signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Aldosterone-regulated sodium reabsorption
Toxoplasmosis
Hepatitis C
Proteoglycans in cancer
Endometrial cancer
Prostate cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Organismal Systems; Excretory system; Aldosterone-regulated sodium reabsorption [PATH:hsa04960]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
Human Diseases; Cancers; Endometrial cancer [PATH:hsa05213]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:hsa05223]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 454 aa AA seqDB search
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRP
GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK
ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET
CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN
SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD
FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA
YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD
SNSFELDLQFSEDEKRLLLEKQAGGNPCLTGRII
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacgccgtgcccatccagtccagcgtggtgtta
tgttcctgcccatccccatcaatggtgaggacccagactgagtccagcacgccccctggc
attcctggtggcagcaggcagggccccgccatggacggcactgcagccgagcctcggccc
ggcgccggctccctgcagcatgcccagcctccgccgcagcctcggaagaagcggcctgag
gacttcaagtttgggaaaatccttggggaaggctctttttccacggttgtcctggctcga
gaactggcaacctccagagaatatgcgattaaaattctggagaagcgacatatcataaaa
gagaacaaggtcccctatgtaaccagagagcgggatgtcatgtcgcgcctggatcacccc
ttctttgttaagctttacttcacatttcaggacgacgagaagctgtatttcggccttagt
tatgccaaaaatggagaactacttaaatatattcgcaaaatcggttcattcgatgagacc
tgtacccgattttacacggctgagattgtgtctgctttagagtacttgcacggcaagggc
atcattcacagggaccttaaaccggaaaacattttgttaaatgaagatatgcacatccag
atcacagattttggaacagcaaaagtcttatccccagagagcaaacaagccagggccaac
tcattcgtgggaacagcgcagtacgtttctccagagctgctcacggagaagtccgcctgt
aagagttcagacctttgggctcttggatgcataatataccagcttgtggcaggactccca
ccattccgagctggaaacgagtatcttatatttcagaagatcattaagttggaatatgac
tttccagaaaaattcttccctaaggcaagagacctcgtggagaaacttttggttttagat
gccacaaagcggttaggctgtgaggaaatggaaggatacggacctcttaaagcacacccg
ttcttcgagtccgtcacgtgggagaacctgcaccagcagacgcctccgaagctcaccgct
tacctgccggctatgtcggaagacgacgaggactgctatggcaattatgacaatctcctg
agccagtttggctgcatgcaggtgtcttcgtcctcctcctcacactccctgtcagcctcc
gacacgggcctgccccagaggtcaggcagcaacatagagcagtacattcacgatctggac
tcgaactcctttgaactggacttacagttttccgaagatgagaagaggttgttgttggag
aagcaggctggcggaaacccttgcctaacaggacgtattatctga

DBGET integrated database retrieval system