KEGG   Homo sapiens (human): 51715Help
Entry
51715             CDS       T01001                                 

Gene name
RAB23, HSPC137
Definition
RAB23, member RAS oncogene family
Orthology
K06234  
Ras-related protein Rab-23
Organism
hsa  Homo sapiens (human)
Pathway
Hedgehog signaling pathway
Disease
H00458  
Craniosynostosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    51715 (RAB23)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab23
    51715 (RAB23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
LinkDB All DBs
Position
6p11
AA seq 237 aa AA seqDB search
MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRL
MLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQ
NKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAED
PELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgttggaggaagatatggaagtcgccataaagatggtggttgtagggaatggagcagtt
ggaaaatcaagtatgattcagcgatattgcaaaggcatttttacaaaagactacaagaaa
accattggagttgattttttggagcgacaaattcaagttaatgatgaagatgtcagacta
atgttatgggacactgcaggtcaggaggaatttgatgcaattacaaaggcctactatcga
ggagcccaggcttgtgtgctcgtgttctctaccacagatagggaatcttttgaagcagtt
tccagttggagagagaaagtagtagccgaagtgggagatataccaactgtacttgtgcaa
aacaagattgatcttctggatgattcttgtataaagaatgaggaagctgaggcactggca
aaaaggttaaagttaagattctacagaacatcagtgaaagaagatctaaatgtgaatgaa
gtttttaagtatttggctgaaaaataccttcagaaactcaaacaacaaatagctgaggat
ccagaactaacgcattcaagtagtaacaagattggtgtctttaatacatctggtggaagt
cactccggtcagaattcaggtaccctcaatggtggagatgtcatcaatcttagacccaac
aaacaaaggaccaagaaaaacagaaatccttttagcagctgtagcataccctaa

DBGET integrated database retrieval system