KEGG   Homo sapiens (human): 51715Help
Entry
51715             CDS       T01001                                 

Gene name
RAB23, HSPC137
Definition
(RefSeq) RAB23, member RAS oncogene family
  KO
K06234  Ras-related protein Rab-23
Organism
hsa  Homo sapiens (human)
Disease
H00458  Craniosynostosis
H01888  Carpenter syndrome
Brite
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    51715 (RAB23)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab23
    51715 (RAB23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase GTP_EFTU ATP_bind_1 Gtr1_RagA G-alpha HGTP_anticodon2 MMR_HSR1_Xtn AAA_16
Motif
Other DBs
NCBI-GeneID: 51715
NCBI-ProteinID: NP_001265595
OMIM: 606144
HGNC: 14263
Ensembl: ENSG00000112210
Vega: OTTHUMG00000014918
Pharos: Q9ULC3(Tbio)
UniProt: Q9ULC3 A0A024RD41
LinkDB All DBs
Position
6p12.1-p11.2
AA seq 237 aa AA seqDB search
MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRL
MLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQ
NKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAED
PELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgttggaggaagatatggaagtcgccataaagatggtggttgtagggaatggagcagtt
ggaaaatcaagtatgattcagcgatattgcaaaggcatttttacaaaagactacaagaaa
accattggagttgattttttggagcgacaaattcaagttaatgatgaagatgtcagacta
atgttatgggacactgcaggtcaggaggaatttgatgcaattacaaaggcctactatcga
ggagcccaggcttgtgtgctcgtgttctctaccacagatagggaatcttttgaagcagtt
tccagttggagagagaaagtagtagccgaagtgggagatataccaactgtacttgtgcaa
aacaagattgatcttctggatgattcttgtataaagaatgaggaagctgaggcactggca
aaaaggttaaagttaagattctacagaacatcagtgaaagaagatctaaatgtgaatgaa
gtttttaagtatttggctgaaaaataccttcagaaactcaaacaacaaatagctgaggat
ccagaactaacgcattcaagtagtaacaagattggtgtctttaatacatctggtggaagt
cactccggtcagaattcaggtaccctcaatggtggagatgtcatcaatcttagacccaac
aaacaaaggaccaagaaaaacagaaatccttttagcagctgtagcataccctaa

DBGET integrated database retrieval system