KEGG   Homo sapiens (human): 5213Help
Entry
5213              CDS       T01001                                 

Gene name
PFKM, GSD7, PFK-1, PFK1, PFKA, PFKX
Definition
phosphofructokinase, muscle (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Disease
H00069  
Glycogen storage diseases (GSD)
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hsa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hsa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hsa00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12q13.3
AA seq 780 aa AA seqDB search
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSV
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcaccatgcagccaaaaccctggggattggcaaagccattgctgtc
ttaacctctggtggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggtatcttcaccggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtggat
ggtggagatcacatcaaggaagccacctgggagagcgtttcgatgatgcttcagctggga
ggcacggtgattggaagtgcccggtgcaaggactttcgggaacgagaaggacgactccga
gctgcctacaacctggtgaagcgtgggatcaccaatctctgtgtcattgggggtgatggc
agcctcactggggctgacaccttccgttctgagtggagtgacttgttgagtgacctccag
aaagcaggtaagatcacagatgaggaggctacgaagtccagctacctgaacattgtgggc
ctggttgggtcaattgacaatgacttctgtggcaccgatatgaccattggcactgactct
gccctgcatcggatcatggaaattgtagatgccatcactaccactgcccagagccaccag
aggacatttgtgttagaagtaatgggccgccactgtggatacctggcccttgtcacctct
ctgtcctgtggggccgactgggtttttattcctgaatgtccaccagatgacgactgggag
gaacacctttgtcgccgactcagcgagacaaggacccgtggttctcgtctcaacatcatc
attgtggctgagggtgcaattgacaagaatggaaaaccaatcacctcagaagacatcaag
aatctggtggttaagcgtctgggatatgacacccgggttactgtcttggggcatgtgcag
aggggtgggacgccatcagcctttgacagaattctgggcagcaggatgggtgtggaagca
gtgatggcacttttggaggggaccccagataccccagcctgtgtagtgagcctctctggt
aaccaggctgtgcgcctgcccctcatggaatgtgtccaggtgaccaaagatgtgaccaag
gccatggatgagaagaaatttgacgaagccctgaagctgagaggccggagcttcatgaac
aactgggaggtgtacaagcttctagctcatgtcagacccccggtatctaagagtggttcg
cacacagtggctgtgatgaacgtgggggctccggctgcaggcatgaatgctgctgttcgc
tccactgtgaggattggccttatccagggcaaccgagtgctcgttgtccatgatggtttc
gagggcctggccaaggggcagatagaggaagctggctggagctatgttgggggctggact
ggccaaggtggctctaaacttgggactaaaaggactctacccaagaagagctttgaacag
atcagtgccaatataactaagtttaacattcagggccttgtcatcattgggggctttgag
gcttacacagggggcctggaactgatggagggcaggaagcagtttgatgagctctgcatc
ccatttgtggtcattcctgctacagtctccaacaatgtccctggctcagacttcagcgtt
ggggctgacacagcactcaatactatctgcacaacctgtgaccgcatcaagcagtcagca
gctggcaccaagcgtcgggtgtttatcattgagactatgggtggctactgtggctacctg
gctaccatggctggactggcagctggggccgatgctgcctacatttttgaggagcccttc
accattcgagacctgcaggcaaatgttgaacatctggtgcaaaagatgaaaacaactgtg
aaaaggggcttggtgttaaggaatgaaaagtgcaatgagaactataccactgacttcatt
ttcaacctgtactctgaggaggggaagggcatcttcgacagcaggaagaatgtgcttggt
cacatgcagcagggtgggagcccaaccccatttgataggaattttgccactaagatgggc
gccaaggctatgaactggatgtctgggaaaatcaaagagagttaccgtaatgggcggatc
tttgccaatactccagattcgggctgtgttctggggatgcgtaagagggctctggtcttc
caaccagtggctgagctgaaggaccagacagattttgagcatcgaatccccaaggaacag
tggtggctgaaactgaggcccatcctcaaaatcctagccaagtacgagattgacttggac
acttcagaccatgcccacctggagcacatcacccggaagcggtccggggaagctgccgtc
taa

DBGET integrated database retrieval system